


| Basic Information | |
|---|---|
| Taxon OID | 3300001580 Open in IMG/M |
| Scaffold ID | Draft_10331646 Open in IMG/M |
| Source Dataset Name | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | McGill University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 643 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Suncor Tailings Pond 6, Northern Alberta, Canada | |||||||
| Coordinates | Lat. (o) | 57.05 | Long. (o) | -111.55 | Alt. (m) | Depth (m) | 6 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F041590 | Metagenome | 159 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Draft_103316461 | F041590 | N/A | MYLHHCQCTHALTXAHGNQSHAXXXLTXXXAALPXTSTVPAQXRPLVDSALLDACEQTLNTXVTSKATAGNMNIPAALFDLDKLLTATASRRMTAALLIGMWRNSSKYVLEVAPXLTSQTGSALLRYQANIEKHEKRLAALTGKNPELNMSAEDLDKLMVNLTEADSETPYGEYLAQRTEEVRSKLVEDSEAL* |
| ⦗Top⦘ |