


| Basic Information | |
|---|---|
| Taxon OID | 3300001373 Open in IMG/M |
| Scaffold ID | YBMDRAFT_10223961 Open in IMG/M |
| Source Dataset Name | YB-Mouth-sed |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of South Carolina |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 904 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Youngs Bay mouth | |||||||
| Coordinates | Lat. (o) | 46.17469 | Long. (o) | -123.84933 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F034767 | Metagenome / Metatranscriptome | 174 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| YBMDRAFT_102239611 | F034767 | N/A | MVFGSKIVGATYDILRGVNATIWGGVEGAEKVGKIVKTGISGADVVIGTSHALEDFGCNDVVCGTIDVVGSVSSAVGLVLGNIPATKHLTVITGFVTVGCRSVRYYCKKYGTFWGCTVAAGQGVKEAIKFTVKQ* |
| ⦗Top⦘ |