


| Basic Information | |
|---|---|
| Taxon OID | 3300001372 Open in IMG/M |
| Scaffold ID | YBBDRAFT_1076462 Open in IMG/M |
| Source Dataset Name | YB-Back-sed |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of South Carolina |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1441 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Youngs Bay mouth | |||||||
| Coordinates | Lat. (o) | 46.15968 | Long. (o) | -123.80651 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F028332 | Metagenome / Metatranscriptome | 192 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| YBBDRAFT_10764624 | F028332 | N/A | VLRDFLAERERDQFGGDLPTLKARKDLTDEFRKKMLCDNPVRFYRLSEGEIAAARKARGN |
| ⦗Top⦘ |