


| Basic Information | |
|---|---|
| Taxon OID | 3300001336 Open in IMG/M |
| Scaffold ID | ML7_10167983 Open in IMG/M |
| Source Dataset Name | ML7 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Pennsylvania State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 728 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Benthic Lake → Benthic Lake Microbial Communities From British Columbia, Canada, For Chemocline Samples |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Wetlands, British Columbia | |||||||
| Coordinates | Lat. (o) | 49.283333 | Long. (o) | -119.583333 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F048914 | Metagenome / Metatranscriptome | 147 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| ML7_101679832 | F048914 | N/A | MFSTLGQSAQVYNSDLGEFVRDDHVRFAQILQDLKPTYSLVYVPVKDRSTPEEQQKPWAIIDRPDNQPEYVVRFLSEEDMKEPHKIIAWLFDGDIVRHGADNVLKRIEAEENAKKLLELKKQEDELEDRIELGAFFATGGRDKLHTFTHNGKKF |
| ⦗Top⦘ |