


| Basic Information | |
|---|---|
| Taxon OID | 3300001325 Open in IMG/M |
| Scaffold ID | LCLOrf001_1014616 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from the Red Sea - Atlantis II brine metagenomic assembly |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 691 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Red Sea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Red Sea | |||||||
| Coordinates | Lat. (o) | 21.351508 | Long. (o) | 38.078207 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F052244 | Metagenome | 143 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| LCLOrf001_10146162 | F052244 | AGGA | MSDKLRTEIYLLLLTLALSLVVAIVTFYIVAGTWARIDRGLDQIDNMLACMKGCPP* |
| ⦗Top⦘ |