


| Basic Information | |
|---|---|
| Taxon OID | 3300001228 Open in IMG/M |
| Scaffold ID | SwM_105728 Open in IMG/M |
| Source Dataset Name | Switchgrass rhizosphere microbial communities from Knoxville, Tennessee, USA - 12_joined |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Tennessee |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 534 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere → Switchgrass Rhizosphere Microbial Communities From Knoxville, Tennessee, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | East Tennessee Research and Education Center, Knoxville, Tennessee, USA | |||||||
| Coordinates | Lat. (o) | 35.9606 | Long. (o) | -83.9208 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F053475 | Metagenome / Metatranscriptome | 141 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| SwM_1057282 | F053475 | N/A | LGIGSDSGITLLTGFFIGTALTWFSTIELLCHLGEKQGRQIMLRVMQSLCVLCIAAGVVQLARAANLLGI* |
| ⦗Top⦘ |