


| Basic Information | |
|---|---|
| Taxon OID | 3300000931 Open in IMG/M |
| Scaffold ID | JGI12531J12852_10000008 Open in IMG/M |
| Source Dataset Name | Aerobic enrichment media microbial communities from Bioluminiscent Bay, La Parguera, Puerto Rico - Tt and P1 (2) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 265845 |
| Total Scaffold Genes | 385 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 37 (9.61%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | (Source: IMG-VR) |
| Source Dataset Ecosystem |
|---|
| Engineered → Lab Enrichment → Defined Media → Aerobic Media → Unclassified → Aerobic Enrichment Media → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Bioluminescent Bay, La Paraguera, Puerto Rico | |||||||
| Coordinates | Lat. (o) | 17.967317 | Long. (o) | -67.018833 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F015419 | Metagenome / Metatranscriptome | 255 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI12531J12852_1000000893 | F015419 | N/A | MNLIINHKLNMKLELKITDEQGNEHLYNVVRSSDGEPNNLNDFILDALQISEDKRKLPFIITTPNGSEYYPLIKMKYENYGSSILGDKLEALIVRW* |
| ⦗Top⦘ |