


| Basic Information | |
|---|---|
| Taxon OID | 3300000929 Open in IMG/M |
| Scaffold ID | NpDRAFT_10077077 Open in IMG/M |
| Source Dataset Name | Marine plume microbial communities from the Columbia River - 15 PSU |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Maryland |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4574 |
| Total Scaffold Genes | 9 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (55.56%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine → Freshwater And Marine Microbial Communities From The Columbia River, Usa, Of Estuaries And Plumes Across Salinity Gradients |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Columbia River plume, coastal ocean | |||||||
| Coordinates | Lat. (o) | 46.239 | Long. (o) | -124.161 | Alt. (m) | Depth (m) | 1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F006657 | Metagenome / Metatranscriptome | 367 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| NpDRAFT_100770777 | F006657 | GGA | MKLAELIKTKANRVLGIDASTNSIAFCLMENNVPIKWGKIELSGADIYEKIYDAKVKMHAMLNELESDYIAVEGAILVRSPDAVIKL |
| ⦗Top⦘ |