


| Basic Information | |
|---|---|
| Taxon OID | 3300000892 Open in IMG/M |
| Scaffold ID | JGI1678J12821_1005353 Open in IMG/M |
| Source Dataset Name | Marine sediment microbial community from Union City, CA, USA - Pond 2C Sediment 2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1226 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Eden Landing Ponds, San Francisco, CA, USA | |||||||
| Coordinates | Lat. (o) | 37.569017 | Long. (o) | -122.102433 | Alt. (m) | Depth (m) | .11 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F024682 | Metagenome / Metatranscriptome | 205 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI1678J12821_10053533 | F024682 | AGGAG | LSAEDELISKLKEEIGKTVPPMFAEIAKDMMEKNKEVIINLLKDNKNLVKEVIES* |
| ⦗Top⦘ |