


| Basic Information | |
|---|---|
| Taxon OID | 3300000883 Open in IMG/M |
| Scaffold ID | EsDRAFT_10003342 Open in IMG/M |
| Source Dataset Name | Estuary microbial communities from the Columbia River - 5 PSU |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Maryland |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2434 |
| Total Scaffold Genes | 8 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (25.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Freshwater And Marine → Freshwater And Marine Microbial Communities From The Columbia River, Usa, Of Estuaries And Plumes Across Salinity Gradients |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Columbia River estuary | |||||||
| Coordinates | Lat. (o) | 46.235 | Long. (o) | -123.91 | Alt. (m) | Depth (m) | 1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001923 | Metagenome / Metatranscriptome | 617 | Y |
| F036603 | Metagenome | 169 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| EsDRAFT_100033427 | F001923 | N/A | MSPPPPIDNEATQSLVKDGLVASILGGLAMTARLLLSTEPVSPGWVLRRISAAAITAALVGYAITDHISSPGLRMGVVGAAGYAAPEVMDYVLKYLKARGEAEVAKVTKKLHDKKKPTKRSK* |
| EsDRAFT_100033428 | F036603 | AGG | MTKRNPPSGASEANLLWATVALVVCAGMAAVSVAYISDLILSSFANSSTMALLITDAGTKSDDAGLERQLTSATMGLKACRDLGWALAVGCLGVGVAVFLRFRRQNAS* |
| ⦗Top⦘ |