


| Basic Information | |
|---|---|
| Taxon OID | 3300000792 Open in IMG/M |
| Scaffold ID | BS_KBA_SWE02_21mDRAFT_10006250 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 02_21m |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4203 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | KBA site, Vaertahamnen, Baltic Sea, Sweden | |||||||
| Coordinates | Lat. (o) | 59.363333 | Long. (o) | 18.119167 | Alt. (m) | Depth (m) | 21 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F047753 | Metagenome / Metatranscriptome | 149 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| BS_KBA_SWE02_21mDRAFT_100062505 | F047753 | GGAGG | MKKIIGILEELRIDDAWLRVAPFALAGCRKESYGKLTRLCRRKETLMAVVVAGVIGLYSAKKHIGLCKKAVKAGKNAYKDSDRELNKYLDAIWRVYILDNSIDKQRLIEKAIGCLSGKLDQELSHSLTEAKKEYKAMIQQIIGAVQADTGHSENAVHGYL |
| ⦗Top⦘ |