


| Basic Information | |
|---|---|
| Taxon OID | 3300000550 Open in IMG/M |
| Scaffold ID | F24TB_12827962 Open in IMG/M |
| Source Dataset Name | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 792 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From Kansas Great Prairie, Usa, Amended With Brdu |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Kanza Prairie, Kansas, USA | |||||||
| Coordinates | Lat. (o) | 39.100992 | Long. (o) | -96.608258 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F074835 | Metagenome / Metatranscriptome | 119 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| F24TB_128279621 | F074835 | N/A | CPRHRECPCRRDRILAAFVFANLAAFVGLTYGLSAWLXXXXXXXXXXXXGAGLLVALMVRAGKVTGWRWWRVFTAGAEETSKELERARAEAEQAVRETLMQLAPAISVEIATAAVPIAGDMAGDVVEAGQDLLETSDEMAEAMAEDLPGDGVVNQMWDVVLVPGRLGLRVATTVLERGETRD* |
| ⦗Top⦘ |