


| Basic Information | |
|---|---|
| Taxon OID | 3300000443 Open in IMG/M |
| Scaffold ID | F12B_11054303 Open in IMG/M |
| Source Dataset Name | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 728 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From Kansas Great Prairie, Usa, Amended With Brdu |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Kanza Prairie, Kansas, USA | |||||||
| Coordinates | Lat. (o) | 39.100992 | Long. (o) | -96.608258 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F006727 | Metagenome | 366 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| F12B_110543032 | F006727 | GAGG | MSTRGILCASLYALSVAGCASTSPPPAGVLVVDDASRVSGCRALGTVADNALDDLQKKAAKLGGNVALMTPQRTSKGGYFGLQDYMTADVYRCEATQATPKS* |
| ⦗Top⦘ |