NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold TBL_comb48_EPIDRAFT_1004267

Scaffold TBL_comb48_EPIDRAFT_1004267


Overview

Basic Information
Taxon OID3300000439 Open in IMG/M
Scaffold IDTBL_comb48_EPIDRAFT_1004267 Open in IMG/M
Source Dataset NameTrout Bog Lake June 7 2007 Epilimnion (Trout Bog Lake Combined Assembly 48 Epilimnion Samples, Aug 2012 Assem)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9187
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (22.22%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameTrout Bog, Vilas County, Wisconsin, USA
CoordinatesLat. (o)46.0412Long. (o)-89.6864Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F082060Metagenome113N

Sequences

Protein IDFamilyRBSSequence
TBL_comb48_EPIDRAFT_100426717F082060N/AMKNWKQYAEHYGYGLVASCWNAGISALYAAFGQSAGAAVMKDVPTPTEHEIITIFVGACALEALAYFKSNPLPVINDEKINPTTPASS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.