


| Basic Information | |
|---|---|
| Taxon OID | 3300000348 Open in IMG/M |
| Scaffold ID | GreS_7680CDRAFT_1011915 Open in IMG/M |
| Source Dataset Name | Acidic sulfate chloride spring microbial streamer communities from Grendel Spring, Yellowstone National Park, USA - T=76-80 |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 718 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Grendel Spring, Yellowstone National park. Wyoming, USA | |||||||
| Coordinates | Lat. (o) | 44.7230812 | Long. (o) | -110.7095749 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F067920 | Metagenome / Metatranscriptome | 125 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| GreS_7680CDRAFT_10119152 | F067920 | N/A | MPADLIFGISDQGLFGAISSVLEYILSFLKTLIEQASVYAIDFLKELWNDPQRTITFLTLLGVALV* |
| ⦗Top⦘ |