NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold TB_LI09_4DRAFT_10293857

Scaffold TB_LI09_4DRAFT_10293857


Overview

Basic Information
Taxon OID3300000231 Open in IMG/M
Scaffold IDTB_LI09_4DRAFT_10293857 Open in IMG/M
Source Dataset NameGroundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- LI09_4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)512
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater → Groundwater Microbial Communities From Subsurface Biofilms In Sulfidic Aquifier In Frasassi Gorge, Italy

Source Dataset Sampling Location
Location NameLago Infinito, wall in 6.8 m depth, Frasassi Caves, Italy
CoordinatesLat. (o)43.383333Long. (o)12.95Alt. (m)Depth (m)6.8
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000926Metagenome / Metatranscriptome832Y

Sequences

Protein IDFamilyRBSSequence
TB_LI09_4DRAFT_102938571F000926AGGAMAQFQGPTPNGPAVQELEVLVRTALFKPANALVGFLLQGAADRIDAAYQPAPGQVRKGRETRQVQGLFGTFPLARDYYYHAGKRQGHAPADAALGLETGQTPALARLVCLEGADETSYQKAENHLLETGGISVS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.