


| Basic Information | |
|---|---|
| Taxon OID | 3300000210 Open in IMG/M |
| Scaffold ID | LowMDraftT1_c178202 Open in IMG/M |
| Source Dataset Name | Sheep rumen microbial communities from New Zealand - Low methane emitting sheep |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 627 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Digestive System → Foregut → Rumen → Sheep Rumen → Sheep Rumen Microbial Communities From New Zealand From High And Low Methane Emitting Sheep |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Hamilton, New Zealand | |||||||
| Coordinates | Lat. (o) | -45.483333 | Long. (o) | 170.716667 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F019925 | Metagenome / Metatranscriptome | 227 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| LowMDraftT1_1782021 | F019925 | N/A | HKSNLKKITTGTWKDLLDLKVECPNRGVLKNFVLRKDSTNIWYDFQCYSSEDYSNDEGEPIIKGLALSSAYKYDISIQENIRTLSDYPIECWVDYGLSSFMLYNDNGLKRDATCYGLKAKYTSKIAIKTATGKALATKIDGLVGITVGSTEQETDDNIAYPLRGFKYNIDISGSKEKPTISYYYGYSILKNLKKLKENAKNTFESLRNS |
| ⦗Top⦘ |