


| Basic Information | |
|---|---|
| Taxon OID | 3300000035 Open in IMG/M |
| Scaffold ID | HCE12Call500_c0293898 Open in IMG/M |
| Source Dataset Name | Hoatzin crop microbial communities from Cojedes, Venezuela - Epithelial fraction 12 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 7541 |
| Total Scaffold Genes | 9 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Birds → Digestive System → Crop → Lumen → Hoatzin Crop → Hoatzin Crop Microbial Communities From Cojedes, Venezuela |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Cojedes, Venezuela | |||||||
| Coordinates | Lat. (o) | 8.956944 | Long. (o) | -68.299167 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F004001 | Metagenome | 457 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| HCE12Call500_02938989 | F004001 | N/A | AVVESPSLEEFKNRVDVALHDMVFSRHHGVGVTVGLDDLRGLF* |
| ⦗Top⦘ |