


| Basic Information | |
|---|---|
| Taxon OID | 2236876016 Open in IMG/M |
| Scaffold ID | DUSEL06_c02938 Open in IMG/M |
| Source Dataset Name | Mine water biofilm microbial communities from Lead, South Dakota, sample from rock fracture pool HS4850BF040511-1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Florida |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1271 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Deep Underground Science And Engineering Laboratory Groundwater → Deep Underground Science And Engineering Laboratory Groundwater Microbial Communities From South Dakota, Us |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Deep Underground Science and Engineering Laboratory, Lead, SD, USA | |||||||
| Coordinates | Lat. (o) | 44.3427 | Long. (o) | -103.7606 | Alt. (m) | Depth (m) | 1478 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F043261 | Metagenome / Metatranscriptome | 156 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| DUSEL06_029381 | F043261 | N/A | KCKTHGRASRYEVSPQEREQRRKIALAARIQKETRLRILQSVRQELPGALSRADFEMVALDYFRRLGHDNHHRLFQVYGWEEKKTKTSWGGMSVEHEKLALDRIRSMSIADLNRFMVTCGIVPDLYYSGFGGDDVLSKDSNLSQAASRHKISAAKIASAVRAELSARTRNSRGKKRASKKRKAE |
| ⦗Top⦘ |