


| Basic Information | |
|---|---|
| Taxon OID | 2222084011 Open in IMG/M |
| Scaffold ID | 2225762010 Open in IMG/M |
| Source Dataset Name | Coastal lagoon microbial communities from Albufera, Spain - Sample 1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University Miguel Hernandez |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5447 |
| Total Scaffold Genes | 9 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (55.56%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Coastal Lagoon → Coastal Lagoon Microbial Communities From Mar Menor And Albufera, Spain |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Spain: La Albufera de Valencia | |||||||
| Coordinates | Lat. (o) | 39.330917 | Long. (o) | -0.343 | Alt. (m) | Depth (m) | .3 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F032997 | Metagenome / Metatranscriptome | 178 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| 2225178511 | F032997 | GGA | VTKQRGSFSKTITLPNTPTNRACFAYAYNIQSFVGGFQPNKRIRAAMWEDGVQVFSGVLQLLSMSKTKGTVTYEVGLFTDNVSLFKAIEGNMLVNTAGVTGMNHTPTSGHVSGTWTASGALSSGYGLRGG |
| ⦗Top⦘ |