


| Basic Information | |
|---|---|
| Taxon OID | 2209111018 Open in IMG/M |
| Scaffold ID | Meso_c880274 Open in IMG/M |
| Source Dataset Name | Mesophilic bioreactor microbial communities at Bielefeld, Germany |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | West Virginia State University |
| Sequencing Status | Finished |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 505 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Solid Waste → Grass → Composting → Bioreactor → Solid Waste From Bioreactor → Microbial Communities From Bioreactor At West Virginia State University,Usa And At Bielefeld, Germany |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Germany: Werther, Bielefeld | |||||||
| Coordinates | Lat. (o) | 52.09722606 | Long. (o) | 8.43561172 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F072352 | Metagenome / Metatranscriptome | 121 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Meso_8802742 | F072352 | AGGTGG | MSSKTGGSFSNLRRAPTAVHLPCCKNGCGEMLALDDGWQCPVCNWYRGYYRGERHP |
| ⦗Top⦘ |