


| Basic Information | |
|---|---|
| Taxon OID | 2170459023 Open in IMG/M |
| Scaffold ID | GZGNO2B01DFAY7 Open in IMG/M |
| Source Dataset Name | Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | 454 Life Sciences |
| Sequencing Status | Finished |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 513 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil → Grass Soil Microbial Communities From Rothamsted Park Plot 3D, Harpenden, Uk |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Maryland: Natonal Institute of Health | |||||||
| Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | Depth (m) | 0 to .21 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F078843 | Metagenome / Metatranscriptome | 116 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| FA3_00087860 | F078843 | N/A | RVLRAESYMLTTRTSRYLRHVGDLGVWTNAPYIQIHPAPRSGTCTPHDPASKNTSEIINGYRVVVKRMPIGGVPQQELCAAHAGGFWLSIIEFGAHPSVEAA |
| ⦗Top⦘ |