


| Basic Information | |
|---|---|
| Taxon OID | 2166559007 Open in IMG/M |
| Scaffold ID | BAAU01018850 Open in IMG/M |
| Source Dataset Name | Human fecal microbial communities from France, for comparison studies - Human1 (F1-S 0939) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | 454 Life Sciences |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 538 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → unclassified Faecalibacterium → Faecalibacterium sp. Marseille-P9312 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Environmental And Host-Associated → Microbial Communities From The Atlantic Ocean And Human Feces From France, Grouped Together For A Comparative Study |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | St. Chamond, France | |||||||
| Coordinates | Lat. (o) | 45.460129 | Long. (o) | 4.495284 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F062845 | Metagenome | 130 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Human1-_00132540 | F062845 | AGGGGG | MKKTPFILHEKFRSENNEQRKERFQKEFERYIIDGLLNAVPSRSCA |
| ⦗Top⦘ |