


| Basic Information | |
|---|---|
| Taxon OID | 2156126007 Open in IMG/M |
| Scaffold ID | GZIBSPL01A53KL Open in IMG/M |
| Source Dataset Name | Estuarine microbial communities from Columbia river, CM, sample from South Channel ETM site, CRE-ETM-794-796 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of South Carolina |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 509 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Columbia River estuary, South Channel ETM site near Astoria (OR) | |||||||
| Coordinates | Lat. (o) | 46.201 | Long. (o) | -123.821 | Alt. (m) | Depth (m) | 14 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F087745 | Metagenome / Metatranscriptome | 110 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| GZIBSPL01_0423.00000210 | F087745 | GAGG | MSDTTVLLQPVGIVHTPKDLKELEAYIGKFHGGEAIAAFTCAWMAWNLCAKLTNPEGRKADEHA |
| ⦗Top⦘ |