


| Basic Information | |
|---|---|
| Taxon OID | 2140918007 Open in IMG/M |
| Scaffold ID | ConsensusfromContig65297 Open in IMG/M |
| Source Dataset Name | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1485 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil → Soil Microbial Communities From Permafrost In Bonanza Creek, Alaska |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Bonanza creek, Alaska, USA | |||||||
| Coordinates | Lat. (o) | 64.7 | Long. (o) | -148.3 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002483 | Metagenome / Metatranscriptome | 555 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| A_all_C_00774140 | F002483 | GGA | MERLRALPVFAEGPLAARSPELKVRRASRRPQRLGFAVPSEYRLSVTAYPGVRPGDLLETLLHELVHLHVGRAAEAHAWHGPTFKRTLALAMREGYGVAARNARGARHGAYAEAIEVARG |
| ⦗Top⦘ |