


| Basic Information | |
|---|---|
| Taxon OID | 2088090005 Open in IMG/M |
| Scaffold ID | LWSO_GFMCQXZ02GWPLN Open in IMG/M |
| Source Dataset Name | Sediment microbial communities from Lake Washington, Seattle, for Methane and Nitrogen Cycles, original sample replicate 1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 560 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment → Freshwater Sediment Microbial Communities From Lake Washington, Seattle, Usa, For Methane And Nitrogen Cycles |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Washington, Seattle | |||||||
| Coordinates | Lat. (o) | 47.052 | Long. (o) | -122.267889 | Alt. (m) | Depth (m) | 62 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F034947 | Metagenome / Metatranscriptome | 173 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| LWSO_05820670 | F034947 | GAG | MNRSYPEGKWLLLCIGTGRVTLADSINRLKPPNESHRKVDKGSTRTGKITQARQAA |
| ⦗Top⦘ |