


| Basic Information | |
|---|---|
| Taxon OID | 2065487001 Open in IMG/M |
| Scaffold ID | bke_il_soap_contig_39669 Open in IMG/M |
| Source Dataset Name | Human fecal microbial communities from Baylor College of Medicine, Texas, USA, mock community - bke_il_soap |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Baylor College of Medicine |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2136 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (20.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Baylor College Of Medicine, Texas, Usa, Mock Community |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Baylor School of Medicine, Houston, Texas, USA | |||||||
| Coordinates | Lat. (o) | 29.7 | Long. (o) | -95.38 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F074899 | Metagenome / Metatranscriptome | 119 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| bke_il_soap_00698360 | F074899 | N/A | MSGRKQWNKQAVTSSFLDKKPPESLILQGLEGSTTLGKDEVGSSNLPSSSK |
| ⦗Top⦘ |