


| Basic Information | |
|---|---|
| Taxon OID | 2061766003 Open in IMG/M |
| Scaffold ID | GB_4MN_MetaGALL_nosff_c605 Open in IMG/M |
| Source Dataset Name | Hydrothermal vent microbial communities from Guaymas and Carmen Basins, Gulf of California, Sample 457 |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Pennsylvania State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 868 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Thioglobus | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Hydrothermal Vent Microbial Communities From Guaymas And Carmen Basins, Gulf Of California |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Gulf of California | |||||||
| Coordinates | Lat. (o) | 27.506 | Long. (o) | -111.347 | Alt. (m) | Depth (m) | 1996 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F084730 | Metagenome / Metatranscriptome | 112 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| GB_4MN_01531590 | F084730 | N/A | TVAILDSVEPVFTVGYFSYLNCIASGVYLYDLGNRIYGYGTPKRALIFFNSFYK |
| ⦗Top⦘ |