


| Basic Information | |
|---|---|
| Taxon OID | 2058419004 Open in IMG/M |
| Scaffold ID | GBSWBV_contig06147 Open in IMG/M |
| Source Dataset Name | Hot spring viral communities from Great Boiling Spring, Nevada - |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 806 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Unclassified → Unclassified → Hot Spring → Hot Spring Microbial Communities From Great Boiling Spring, Nevada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Great Boiling Spring, Nevada | |||||||
| Coordinates | Lat. (o) | 40.65833 | Long. (o) | -119.37772 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F104050 | Metagenome | 101 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| GBSWBV_00547570 | F104050 | N/A | CVVFENLVDEEKQKYGSKEFVVTYCSMCIKTYYAKAKHKLVNKFSVVNTL |
| ⦗Top⦘ |