


| Basic Information | |
|---|---|
| Taxon OID | 2035918001 Open in IMG/M |
| Scaffold ID | WWPM1086_GHCZ2246_b1 Open in IMG/M |
| Source Dataset Name | Activated sludge microbial communities from Commune de Morges, Switzerland - plasmid pool Visp-2009 (Newbler) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 799 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Aerobic) → Activated Sludge → Wastewater Plasmid Pools → Activated Sludge Microbial Communities From Commune De Morges, Switzerland |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Visp, Switzerland | |||||||
| Coordinates | Lat. (o) | 46.30044 | Long. (o) | 7.8594 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F012842 | Metagenome | 277 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| WWPMV_321440 | F012842 | AGAAG | MIVHGCIEIHLKDCGGWIIVMGFRVLLISQHLFPEILLEAVLGIHAGSVKIKSICIQML |
| ⦗Top⦘ |