


| Basic Information | |
|---|---|
| Taxon OID | 2014642005 Open in IMG/M |
| Scaffold ID | 2014696691 Open in IMG/M |
| Source Dataset Name | Marine plankton microbial communities from Ionian Km3 Station |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 843 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Deep Mediterranean Sea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mediterranean Sea, Ionian Km3 Station | |||||||
| Coordinates | Lat. (o) | 36.4999 | Long. (o) | 15.693611 | Alt. (m) | Depth (m) | 3010 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026397 | Metagenome | 198 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| 2014721838 | F026397 | N/A | LFLTSLFFIFSCADITFYRKPIISVTISSDCHDLYEDNNLYIYISRLGTDWDSDMYVDVGNTEDLAVFVEGKYNITATATSEDSTASNYESIKSIYVYHGEERNVEFDCD |
| ⦗Top⦘ |