


| Basic Information | |
|---|---|
| Taxon OID | 2013843001 Open in IMG/M |
| Scaffold ID | PLMO_C4128 Open in IMG/M |
| Source Dataset Name | Activated sludge microbial communities from Commune de Morges, Switzerland - plasmid pool Morges-2007 (PGA) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 834 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Aerobic) → Activated Sludge → Wastewater Plasmid Pools → Activated Sludge Microbial Communities From Commune De Morges, Switzerland |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Bief, Commune de Morges, Canton Vaud, Switzerland | |||||||
| Coordinates | Lat. (o) | 46.51668 | Long. (o) | 6.510145 | Alt. (m) | Depth (m) | .3 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F021450 | Metagenome | 219 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| PLMO_114470 | F021450 | N/A | MKKTISLLALLLFFSIEMQAQITNVLNNFYSVWVKPAIPIVAGLVLIVGALANMGKVLGESRDYKGFAQGIVLYLAVYLCVVAIVSYIMAG |
| ⦗Top⦘ |