


| Basic Information | |
|---|---|
| Taxon OID | 2006543006 Open in IMG/M |
| Scaffold ID | 2006898029 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from anoxic basin of Saanich Inlet - SI040908_100 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Finished |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 805 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Anoxic Basin Of Saanich Inlet In Vancouver, Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Saanich Inlet, British Columbia, Canada | |||||||
| Coordinates | Lat. (o) | 48.616667 | Long. (o) | -123.5 | Alt. (m) | Depth (m) | 100 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F021318 | Metagenome / Metatranscriptome | 219 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| 2007045714 | F021318 | GGTGG | MTSKVFNQKKADYNGMQLWLNPVDKTVYATESAPTYSFGESNGYAIYDFNKHFENQKMAKDTMGNGSYSHDAFVDSEFKALAEDYVSDIKAGGRQRSAALRSFTNSAVDIVNVWETVLGKDDRTFAGKNLAKEIAVPNLLISIDTATKFSGMTQLDEGQLGQLKELTYARSTFEANKYGLKFVIHEEARLKNVHNVLQDSIQVASNKVEQRQSFDVISVCDSDLTAKAVQGVWD |
| ⦗Top⦘ |