


| Basic Information | |
|---|---|
| Taxon OID | 2004247002 Open in IMG/M |
| Scaffold ID | 2004274217 Open in IMG/M |
| Source Dataset Name | Hypersaline mat microbial communities from Guerrero Negro, Mexico - 2-3 mm depth into microbial mat |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 784 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Salt Crystallizer Ponds → Microbial Mats → Hypersaline Mat → Hypersaline Mat Microbial Communities From Guerrero Negro, Baja California Sur, Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Guerrero Negro, Baja California Sur, Mexico | |||||||
| Coordinates | Lat. (o) | 27.68908 | Long. (o) | -113.917 | Alt. (m) | Depth (m) | 1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003188 | Metagenome / Metatranscriptome | 502 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| 2004276462 | F003188 | N/A | MIDPKKKLRETLFSIHKLSYRIKVTEPPKDLMEKKLFIEIMETLRKIEDRRDFMQEEIGMDMTLYEDEFFLVIENLLKLHFSKEQLALIQLYLYQLTPDKDWDGTITIERDKKEQVVEFKTPADVWKIISAL |
| ⦗Top⦘ |