


| Basic Information | |
|---|---|
| Family ID | F106190 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MPRHPTVQVPNIGPMDHAWDLLGEWQAEFELPETESPVHGKVTFR |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.00 % |
| % of genes from short scaffolds (< 2000 bps) | 91.00 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (35.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (28.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.22% β-sheet: 6.67% Coil/Unstructured: 71.11% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF04362 | Iron_traffic | 23.00 |
| PF00800 | PDT | 3.00 |
| PF11383 | DUF3187 | 2.00 |
| PF13180 | PDZ_2 | 1.00 |
| PF01842 | ACT | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG2924 | Fe-S cluster biosynthesis and repair protein YggX | Posttranslational modification, protein turnover, chaperones [O] | 46.00 |
| COG0077 | Prephenate dehydratase | Amino acid transport and metabolism [E] | 3.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886012|MBSR1b_contig_1092285 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 2058 | Open in IMG/M |
| 3300000953|JGI11615J12901_10965688 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 624 | Open in IMG/M |
| 3300001686|C688J18823_10583722 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 714 | Open in IMG/M |
| 3300003324|soilH2_10219417 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1353 | Open in IMG/M |
| 3300004157|Ga0062590_102139837 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 584 | Open in IMG/M |
| 3300004643|Ga0062591_101810023 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 623 | Open in IMG/M |
| 3300004780|Ga0062378_10053512 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 895 | Open in IMG/M |
| 3300004803|Ga0058862_10644077 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 574 | Open in IMG/M |
| 3300005328|Ga0070676_11279794 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 559 | Open in IMG/M |
| 3300005339|Ga0070660_101242706 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 632 | Open in IMG/M |
| 3300005355|Ga0070671_101211954 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 664 | Open in IMG/M |
| 3300005434|Ga0070709_11472059 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 552 | Open in IMG/M |
| 3300005436|Ga0070713_101958758 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 568 | Open in IMG/M |
| 3300006028|Ga0070717_11953492 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 529 | Open in IMG/M |
| 3300006854|Ga0075425_100032393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae | 5805 | Open in IMG/M |
| 3300006854|Ga0075425_100172831 | All Organisms → cellular organisms → Bacteria | 2480 | Open in IMG/M |
| 3300009081|Ga0105098_10221362 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 882 | Open in IMG/M |
| 3300009148|Ga0105243_11601278 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 678 | Open in IMG/M |
| 3300009166|Ga0105100_10373493 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 860 | Open in IMG/M |
| 3300009171|Ga0105101_10428917 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 645 | Open in IMG/M |
| 3300010037|Ga0126304_10071576 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 2147 | Open in IMG/M |
| 3300010037|Ga0126304_10645271 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 714 | Open in IMG/M |
| 3300010038|Ga0126315_10599679 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 711 | Open in IMG/M |
| 3300010041|Ga0126312_11285881 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 541 | Open in IMG/M |
| 3300010166|Ga0126306_10652970 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 841 | Open in IMG/M |
| 3300010862|Ga0126348_1034853 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 513 | Open in IMG/M |
| 3300011332|Ga0126317_10704159 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 784 | Open in IMG/M |
| 3300012212|Ga0150985_106118836 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 576 | Open in IMG/M |
| 3300012349|Ga0137387_10849813 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 660 | Open in IMG/M |
| 3300012362|Ga0137361_10097448 | All Organisms → cellular organisms → Bacteria | 2551 | Open in IMG/M |
| 3300012469|Ga0150984_121068268 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 529 | Open in IMG/M |
| 3300012685|Ga0137397_10411921 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1007 | Open in IMG/M |
| 3300012922|Ga0137394_11184244 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 628 | Open in IMG/M |
| 3300012943|Ga0164241_11472891 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 500 | Open in IMG/M |
| 3300012960|Ga0164301_11642466 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 535 | Open in IMG/M |
| 3300012988|Ga0164306_11220809 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 631 | Open in IMG/M |
| 3300017787|Ga0183260_10083839 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 2324 | Open in IMG/M |
| 3300017789|Ga0136617_10885416 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 682 | Open in IMG/M |
| 3300017936|Ga0187821_10493860 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 511 | Open in IMG/M |
| 3300017997|Ga0184610_1008291 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 2540 | Open in IMG/M |
| 3300018028|Ga0184608_10339509 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 660 | Open in IMG/M |
| 3300018054|Ga0184621_10093922 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300018063|Ga0184637_10044665 | All Organisms → cellular organisms → Bacteria | 2695 | Open in IMG/M |
| 3300018063|Ga0184637_10522359 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 686 | Open in IMG/M |
| 3300018076|Ga0184609_10091107 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1359 | Open in IMG/M |
| 3300018084|Ga0184629_10660212 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 529 | Open in IMG/M |
| 3300018422|Ga0190265_11994888 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 686 | Open in IMG/M |
| 3300018920|Ga0190273_10224828 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1196 | Open in IMG/M |
| 3300019233|Ga0184645_1189662 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 579 | Open in IMG/M |
| 3300019259|Ga0184646_1576689 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 558 | Open in IMG/M |
| 3300019269|Ga0184644_1718829 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | 847 | Open in IMG/M |
| 3300019279|Ga0184642_1383088 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 556 | Open in IMG/M |
| 3300019377|Ga0190264_10823972 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 711 | Open in IMG/M |
| 3300019878|Ga0193715_1070969 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 731 | Open in IMG/M |
| 3300020006|Ga0193735_1103574 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 791 | Open in IMG/M |
| 3300021088|Ga0210404_10191325 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1093 | Open in IMG/M |
| 3300021413|Ga0193750_1057407 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 796 | Open in IMG/M |
| 3300021418|Ga0193695_1128590 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 525 | Open in IMG/M |
| 3300023058|Ga0193714_1023727 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300025916|Ga0207663_10144754 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1660 | Open in IMG/M |
| 3300025928|Ga0207700_10881844 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 801 | Open in IMG/M |
| 3300025936|Ga0207670_11719514 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 534 | Open in IMG/M |
| 3300025942|Ga0207689_11685590 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 526 | Open in IMG/M |
| 3300025981|Ga0207640_10490200 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1021 | Open in IMG/M |
| 3300027471|Ga0209995_1082215 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 553 | Open in IMG/M |
| 3300027765|Ga0209073_10215964 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 734 | Open in IMG/M |
| 3300027876|Ga0209974_10347862 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 574 | Open in IMG/M |
| 3300028715|Ga0307313_10093326 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 911 | Open in IMG/M |
| 3300028768|Ga0307280_10402199 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 511 | Open in IMG/M |
| 3300028791|Ga0307290_10391320 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 509 | Open in IMG/M |
| 3300028796|Ga0307287_10356261 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 552 | Open in IMG/M |
| 3300028807|Ga0307305_10344539 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 676 | Open in IMG/M |
| 3300028810|Ga0307294_10295065 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 587 | Open in IMG/M |
| 3300028819|Ga0307296_10254884 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300028880|Ga0307300_10185378 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 668 | Open in IMG/M |
| 3300030606|Ga0299906_11183498 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 551 | Open in IMG/M |
| 3300030902|Ga0308202_1112182 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 574 | Open in IMG/M |
| 3300030903|Ga0308206_1148086 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 563 | Open in IMG/M |
| 3300030904|Ga0308198_1082790 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 542 | Open in IMG/M |
| 3300030990|Ga0308178_1144215 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 543 | Open in IMG/M |
| 3300031058|Ga0308189_10292185 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 634 | Open in IMG/M |
| 3300031091|Ga0308201_10256378 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 605 | Open in IMG/M |
| 3300031091|Ga0308201_10326442 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 555 | Open in IMG/M |
| 3300031093|Ga0308197_10203192 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 675 | Open in IMG/M |
| 3300031094|Ga0308199_1026639 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1013 | Open in IMG/M |
| 3300031096|Ga0308193_1058053 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 595 | Open in IMG/M |
| 3300031114|Ga0308187_10398596 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 543 | Open in IMG/M |
| 3300031421|Ga0308194_10040105 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | 1151 | Open in IMG/M |
| 3300031421|Ga0308194_10084564 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 884 | Open in IMG/M |
| 3300031421|Ga0308194_10241370 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 602 | Open in IMG/M |
| 3300031547|Ga0310887_11006235 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 532 | Open in IMG/M |
| 3300031548|Ga0307408_100043142 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 3208 | Open in IMG/M |
| 3300031824|Ga0307413_11350478 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 625 | Open in IMG/M |
| 3300031995|Ga0307409_100251610 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1616 | Open in IMG/M |
| 3300031996|Ga0308176_11450320 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 730 | Open in IMG/M |
| 3300032004|Ga0307414_11739571 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 582 | Open in IMG/M |
| 3300032126|Ga0307415_101730063 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 604 | Open in IMG/M |
| 3300032126|Ga0307415_102096208 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 552 | Open in IMG/M |
| 3300033475|Ga0310811_10553569 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1178 | Open in IMG/M |
| 3300034177|Ga0364932_0126750 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 970 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 35.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 7.00% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 6.00% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 5.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.00% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 4.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.00% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.00% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.00% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.00% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.00% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.00% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.00% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.00% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.00% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.00% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300004780 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh | Environmental | Open in IMG/M |
| 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010862 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019233 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021413 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1 | Environmental | Open in IMG/M |
| 3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
| 3300023058 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m1 | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030904 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031096 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MBSR1b_0717.00004540 | 2162886012 | Miscanthus Rhizosphere | MLRHPTVQVPNIGPMDHAWDLLGEWQAEFEVPEAEV |
| JGI11615J12901_109656881 | 3300000953 | Soil | MPRHPTVVVPNIGPMDHAWDLLGEWQAEFELPETESPVH |
| C688J18823_105837221 | 3300001686 | Soil | MPRHPTVQVPNIGPMDHAWDLLGEWQAEFELPETESPVHGKVMFRSWTDAE |
| soilH2_102194171 | 3300003324 | Sugarcane Root And Bulk Soil | MPRHPTVLVPNIGPMDHAWDLLGEWQAEFELPETESPVHG |
| Ga0062590_1021398371 | 3300004157 | Soil | MPRHPTVQVPNIGPMDHAWDLLGEWQAEFELPETESPVHGKV |
| Ga0062591_1018100232 | 3300004643 | Soil | MPRHPTVLVPNIGPMDHAWDLLGEWQAEFELPETESPVHGTVTFRSWTDAE |
| Ga0062378_100535123 | 3300004780 | Wetland Sediment | MPRHPTVQVPNIGPMDHAWDLLGEWQAEFELPEAESPVHGKVTFRSWTDAEL |
| Ga0058862_106440772 | 3300004803 | Host-Associated | MPRHPTVQVPNIGPMDHAWDLLGEWQAELELPETEDPVHGKVTFRSWT |
| Ga0070676_112797941 | 3300005328 | Miscanthus Rhizosphere | MPRHPTVVVPNIGPMDHAWDLLGEWQAEFELPETESPVHGKVTFRSWTD |
| Ga0070660_1012427062 | 3300005339 | Corn Rhizosphere | MPRHPTVVVPNIGPMDHAWDLLGEWQAEFELPETESPVHGKV |
| Ga0070671_1012119541 | 3300005355 | Switchgrass Rhizosphere | MPRHPTVVVPNIGPMDHAWDLLGEWQAEFELPETESPVHGKVTFRSWT |
| Ga0070709_114720592 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MRHPTVQVPNIGPMDHAWDLLGEWQAEFELPETESPVHGKVTFRSWTDAELSLDPVEA |
| Ga0070713_1019587581 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRHPTVQVPNIGPMDHAWDLLGEWQAEFELPETESPVHGKVTFRSWTD |
| Ga0070717_119534921 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRHPTVQVPNIGPMDHAWDLLGEWQAEFELPETESPVHGKVTFR |
| Ga0075425_1000323931 | 3300006854 | Populus Rhizosphere | MLKHPTVVVPDVGPMDHAWDVLGEWQAELELPEGDEPVR |
| Ga0075425_1001728311 | 3300006854 | Populus Rhizosphere | MLRHPTVQVPNIGPMDHAWDLLGEWQAEFEVPEAEVPVHGKVMFRSWTDAELQLDPIEA |
| Ga0105098_102213621 | 3300009081 | Freshwater Sediment | MNLGGEEATMQRHPTVQVPNIGPMDHAWDLLGEWQAEFELPETEDPVHGKVM |
| Ga0105243_116012781 | 3300009148 | Miscanthus Rhizosphere | MLMRHPTVQVPDIGPMDHAWDILGEWQAEFELPESESPVHGKVTF |
| Ga0105100_103734932 | 3300009166 | Freshwater Sediment | MPRQHPTVQVPNIGPMDHAWDLLGEWQAEFELPETESPVHGKVTFSSWTDAELQLDPV* |
| Ga0105101_104289171 | 3300009171 | Freshwater Sediment | MPRQHPTVQVPNIGPMDHAWDLLGEWQTELELPEAEEPVHGKVTLRS* |
| Ga0126304_100715765 | 3300010037 | Serpentine Soil | MPRHPTVVVPNIGPMDHAWDLLGEWQAEFELPETESPVHG |
| Ga0126304_106452712 | 3300010037 | Serpentine Soil | MPRHPTVVVPNIGPMDHAWDLLGEWQAEFELPETESPV |
| Ga0126315_105996792 | 3300010038 | Serpentine Soil | MLRHPTVQVPNIGPMDHAWDLLGEWQAEFELPETESPVHGK |
| Ga0126312_112858812 | 3300010041 | Serpentine Soil | MFFQGRSQYMPRQHPTVLVPNIGPMDHAWDLLGEWQTEFELPETESPVHGKVTFRSWTD |
| Ga0126306_106529701 | 3300010166 | Serpentine Soil | MPRHPTVQVPNIGPMDHAWDLLGEWQAEFELPETESPVHGKVTF |
| Ga0126348_10348531 | 3300010862 | Boreal Forest Soil | MLRHPTVQVPNIGPMDHAWDLLGEWQAELEVPEGEAPVH |
| Ga0126317_107041591 | 3300011332 | Soil | MLMRHPTVQVPDIGPMDHAWDILGEWQAEFELPESESPVHGKVTFRS |
| Ga0150985_1061188362 | 3300012212 | Avena Fatua Rhizosphere | MRQHPTVLVPNIGPMDHAWDLLGEWQTEFELPETESPVHGKVTFRSWTDAE |
| Ga0137387_108498132 | 3300012349 | Vadose Zone Soil | MPRHPTVQVPNIGPMDHAWDLLGEWQAEFELPETEAPMHG |
| Ga0137361_100974485 | 3300012362 | Vadose Zone Soil | MPRHPTVQVPNIGPMDHAWDLLGEWQAEFELPETESPVHGKVTFRSWTDAELMLDP |
| Ga0150984_1210682681 | 3300012469 | Avena Fatua Rhizosphere | MPRHPTVVVPNIGPMDHAWDLLGEWQAEFELPETE |
| Ga0137397_104119214 | 3300012685 | Vadose Zone Soil | MPRHPTVQVPNIGPMDHAWDLLGEWQAEFELPETEA |
| Ga0137394_111842442 | 3300012922 | Vadose Zone Soil | MHKQHPTVQVPNIGPMDHAWDLLGEWQAEFELPETESPVHGKVTFSSWTDA |
| Ga0164241_114728911 | 3300012943 | Soil | MNIEGEEATMPRHPTVQVPNIGPMDHAWDLLGEWQTEFELPETEDPVHGKVTFRSWTDAQ |
| Ga0164301_116424661 | 3300012960 | Soil | MRHPTVQVPNIGPMDHAWDLLGEWQAEFELPETESPVHGKVTFRSWTDAELSLD |
| Ga0164306_112208092 | 3300012988 | Soil | MRHPTVQVPNIGPMDHAWDLLGEWQAEFELPEMESPVHG |
| Ga0183260_100838395 | 3300017787 | Polar Desert Sand | MPRQHPTVLVPNIGPMDHAWDLLGEWQTEFELPETESPVHGKVTFRSWTDA |
| Ga0136617_108854162 | 3300017789 | Polar Desert Sand | MARQHPTVQVPNIGPMDHAWDLLGEWQTEFELPETESPVHGKVTF |
| Ga0187821_104938601 | 3300017936 | Freshwater Sediment | MRHPTVQVPNIGPMDHAWDLLGEWQAEFELPETESPVHGKVTFRS |
| Ga0184610_10082911 | 3300017997 | Groundwater Sediment | MHRQHPTVQVPNIGPMDHAWDLLGEWQAEFELPETESPVHGKVTF |
| Ga0184608_103395091 | 3300018028 | Groundwater Sediment | MPRHPTVQVPNIGPMDHAWDLLGEWQAEFELPETESPVH |
| Ga0184621_100939221 | 3300018054 | Groundwater Sediment | MPRHPTVQVPNIGPMDHAWDLLGEWQAEFELPETESPVHGKVNFRSWTDAELMLDPI |
| Ga0184637_100446651 | 3300018063 | Groundwater Sediment | MPRQHPTVQVPNIGPMDHAWDLLGEWQAEFELPETESPVHGKV |
| Ga0184637_105223591 | 3300018063 | Groundwater Sediment | MHRQHPTVQVPNIGPMDHAWDLLGEWQAEFELPETESPVHGKV |
| Ga0184609_100911071 | 3300018076 | Groundwater Sediment | MPRHPTVQVPNIGPMDHAWDLLGEWQAEFELPETESPVHGKVNFRSWTDAELMLDPIEAA |
| Ga0184629_106602122 | 3300018084 | Groundwater Sediment | MPRHPTVQVPNIGPMDHAWDLLGEWQAEFELPETESPVHG |
| Ga0190265_119948881 | 3300018422 | Soil | MPRHPVVQVPNIGPMDHAWDLLGEWQAEFELPETEDPVHGKVMFPSWTDA |
| Ga0190273_102248283 | 3300018920 | Soil | MPRHPTVLVPNIGPMDHAWDLLGEWQAEFELPEAESPVHGKVTFRSWTDAELQLDP |
| Ga0184645_11896621 | 3300019233 | Groundwater Sediment | MPRHPTVLVPNIGPMDHAWDLLGEWQAEFELPETESPVHGTVTFRSWTDAELQLDPIE |
| Ga0184646_15766891 | 3300019259 | Groundwater Sediment | MARHPTVQVPNIGPMDHAWDLLGEWQAELEVPEGEAPVH |
| Ga0184644_17188291 | 3300019269 | Groundwater Sediment | MPRHPTVQVPNIGPMDHAWDLLGEWQAELEVPEGEAPVHGKVMFRSWTDA |
| Ga0184642_13830882 | 3300019279 | Groundwater Sediment | MSRHPTVQVPNIGPMDHAWDLLGEWQAEFELPETESPVHGK |
| Ga0190264_108239723 | 3300019377 | Soil | MPRQHPTVQVPNIGPMDHAWDLLGEWQTEFELPETES |
| Ga0193715_10709691 | 3300019878 | Soil | MPRHPTVLVPNIGPMDHAWDLLGEWQAEFELPEAESPVHGKVTFRSWT |
| Ga0193735_11035741 | 3300020006 | Soil | MPRHPTVLVPNIGPMDHAWDLLGEWQAEFELPEAESPVHGKVTF |
| Ga0210404_101913251 | 3300021088 | Soil | MPRHRKHPTVVVPNIGPMDHAWDVLGEWQAELELPEGETPVRGTVTFRSWT |
| Ga0193750_10574071 | 3300021413 | Soil | MPRHPTVLVPNIGPMDHAWDLLGEWQAEFELPEAESPVHGKVTFRSWTDAELQLDPVEA |
| Ga0193695_11285902 | 3300021418 | Soil | MPRHPTVLVPNIGPMDHAWDLLGEWQAEFELPEAESPVHGKVTFRSWTD |
| Ga0193714_10237273 | 3300023058 | Soil | MPRHPTVLVPNIGPMDHAWDLLGEWQAEFELPEAESPVHGKVTFRSW |
| Ga0207663_101447544 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MRHPTVQVPNIGPMDHAWDLLGEWQAEFELPETESPVHGKVTFRSWTDAELSLDPV |
| Ga0207700_108818441 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRHPTVQVPNIGPMDHAWDLLGEWQAEFELPETESPVHGKVTFRSWTDAELMLDPIEA |
| Ga0207670_117195142 | 3300025936 | Switchgrass Rhizosphere | MPRHPTVVVPNIGPMDHAWDLLGEWQAEFELPETESPVHGKVTFRSWTDAELILDP |
| Ga0207689_116855902 | 3300025942 | Miscanthus Rhizosphere | MRHPTVQVPNIGPMDHAWDLLGEWQAEFELPETESPVHGKVNFRSWTDADARA |
| Ga0207640_104902001 | 3300025981 | Corn Rhizosphere | MPRHPTVVVPNIGPMDHAWDLLGEWQAEFELPETESPVHGKVTFRSW |
| Ga0209995_10822152 | 3300027471 | Arabidopsis Thaliana Rhizosphere | MPRQHPTVQVPNIGPMDHAWDLLGEWQAEFELPETESPVHGKVTFSSWTDAELQLDPIE |
| Ga0209073_102159643 | 3300027765 | Agricultural Soil | MRHPTVQVPNIGPMDHAWDLLGEWQAEFELPETES |
| Ga0209974_103478622 | 3300027876 | Arabidopsis Thaliana Rhizosphere | MPRHPTVLVPNIGPMDHAWDLLGEWQAEFELPETESPVHGKV |
| Ga0307313_100933263 | 3300028715 | Soil | MPRHPTVLVPNIGPMDHAWDLLGEWQAEFELPEAESPVHGKVTFRSWTDAEL |
| Ga0307280_104021991 | 3300028768 | Soil | MPRHPTVLVPNIGPMDHAWDLLGEWQAEFELPEAESPVHGKVTFRSWTDAELQLDPVE |
| Ga0307290_103913201 | 3300028791 | Soil | MPRHPTVQVPNIGPMDHAWDLLGEWQAEFELPETESPVHGKVNFRSWTDAE |
| Ga0307287_103562611 | 3300028796 | Soil | MPRHPTVQVPNIGPMDHAWDLLGEWQAEFELPETESPVHGKVNFRSWTDAELMLDP |
| Ga0307305_103445393 | 3300028807 | Soil | MARHPTVQVPNIGPMDHAWDLLGEWQAELEVPEGEAPVHGKVMFRSWT |
| Ga0307294_102950651 | 3300028810 | Soil | MPRHPTVLVPNIGPMDHAWDLLGEWQAEFELPEAESPVHG |
| Ga0307296_102548841 | 3300028819 | Soil | MPRHPTVQVPNIGPMDHAWDLLGEWQAEFELPETES |
| Ga0307300_101853782 | 3300028880 | Soil | MPRHPTVLVPNIGPMDHAWDLLGEWQAEFELPEAES |
| Ga0299906_111834982 | 3300030606 | Soil | MRRHPTVQVPNIGPMDHAWDLLGEWQAEFELPETESPVHGKVTFRSWTDAE |
| Ga0308202_11121821 | 3300030902 | Soil | MPRHPTVQVPNIGPMDHAWDLLGEWQAEFELPETESPVHGTVTFRS |
| Ga0308206_11480861 | 3300030903 | Soil | MPRHPTVQVPNIGPMDHAWDLLGEWQAELEVPEGEAPVHGK |
| Ga0308198_10827901 | 3300030904 | Soil | MPRHPTVQVPNIGPMDHAWDLLGEWQAELEVPEGEAP |
| Ga0308178_11442151 | 3300030990 | Soil | MPRHPTVLVPNIGPMDHAWDLLGEWQAEFELPEAESPVH |
| Ga0308189_102921852 | 3300031058 | Soil | MPRHPTVQVPNIGPMDHAWDLLGEWQAELEVPEGEAPVHGKVMFRSWTDAELQLDPIEA |
| Ga0308201_102563781 | 3300031091 | Soil | MPRHPTVQVPNIGPMDHAWDLLGEWQAEFELPETESPVHGKVTFRSWTDA |
| Ga0308201_103264421 | 3300031091 | Soil | MPRHPTVQVPNIGPMDHAWDLLGEWQAELEVPEGEAPVHG |
| Ga0308197_102031921 | 3300031093 | Soil | MPRHPTVLVPNIGPMDHAWDLLGEWQTEFELPETESPVHGKVTFRSWTDAELQLDPVEAA |
| Ga0308199_10266393 | 3300031094 | Soil | MPRHPTVRVPNIGPMDHAWDLLGEWQAEFELPEAESPVHGKV |
| Ga0308193_10580531 | 3300031096 | Soil | MARHPTVQVPNIGPMDHAWDLLGEWQAELEVPEGEAPVHGKVMFRSWTDAELQLDPIEA |
| Ga0308187_103985961 | 3300031114 | Soil | MPRHPTVQVPNIGPMDHAWDLLGEWQAEFELPEAESPVHGKVTFRS |
| Ga0308194_100401051 | 3300031421 | Soil | MPRHPTVQVPNIGPMDHAWDLLGEWQAELEVPEGEAPVHGKVMFRSWTDAELQLDP |
| Ga0308194_100845641 | 3300031421 | Soil | MPRHPTVLVPNIGPMDHAWDLLGEWQAEFVLPEAASPVHGKVTFRSWTDAA |
| Ga0308194_102413701 | 3300031421 | Soil | MPRHPTVQVPNIGPMDHAWDLLGEWQAELEVPEGEAPVHGKVMFR |
| Ga0310887_110062351 | 3300031547 | Soil | MRHPTVQVPNIGPMDHAWDLLGEWQAEFELPETESPVHG |
| Ga0307408_1000431421 | 3300031548 | Rhizosphere | MPRQHPTVLVPNIGPMDHAWDLLGEWQTEFELPETE |
| Ga0307413_113504782 | 3300031824 | Rhizosphere | MPRHPTVQVPNIGPMDHAWDLLGEWQAEFELPETESPVHGKVT |
| Ga0307409_1002516104 | 3300031995 | Rhizosphere | MPRHPTVLVPNIGPMDHAWDLLGEWQAEFELPETESPVHGKVTF |
| Ga0308176_114503204 | 3300031996 | Soil | MPRHPTVQVPNIGPMDHAWDLLGEWQTEFELPETESP |
| Ga0307414_117395711 | 3300032004 | Rhizosphere | MPRHPTVLIPNIGPMDHAWDLLGEWQAEFELPEAESPVHGKVTFRSWTDAELQL |
| Ga0307415_1017300632 | 3300032126 | Rhizosphere | MPRQHPTVLVPNIGPMDHAWDLLGEWQTEFELPETESP |
| Ga0307415_1020962081 | 3300032126 | Rhizosphere | MPRHPTVLVPNIGPMDHAWDLLGEWQAEFELPETESPVHGKVTFRTWTDAELQLDPV |
| Ga0310811_105535694 | 3300033475 | Soil | MSRHPTVEVPNIGPMDHAWDLLGEWNAELEAPEGESAVHGKVTFRSW |
| Ga0364932_0126750_1_141 | 3300034177 | Sediment | MLKRHPTVQIPDIGPMDHAWDLLGEWQAEFELPESESPVHGKVTFRS |
| ⦗Top⦘ |