


| Basic Information | |
|---|---|
| Family ID | F106126 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 45 residues |
| Representative Sequence | VKKNIALLYGFSFFDQFMIVIALWVPYLTTQGISMRQFMELQA |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 66.00 % |
| % of genes near scaffold ends (potentially truncated) | 94.00 % |
| % of genes from short scaffolds (< 2000 bps) | 87.00 % |
| Associated GOLD sequencing projects | 79 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (22.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.52% β-sheet: 0.00% Coil/Unstructured: 46.48% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF04264 | YceI | 23.00 |
| PF12681 | Glyoxalase_2 | 12.00 |
| PF13302 | Acetyltransf_3 | 7.00 |
| PF08281 | Sigma70_r4_2 | 6.00 |
| PF00903 | Glyoxalase | 5.00 |
| PF07883 | Cupin_2 | 5.00 |
| PF00891 | Methyltransf_2 | 4.00 |
| PF07687 | M20_dimer | 3.00 |
| PF02738 | MoCoBD_1 | 3.00 |
| PF16864 | Dimerisation2 | 3.00 |
| PF00583 | Acetyltransf_1 | 1.00 |
| PF05977 | MFS_3 | 1.00 |
| PF01546 | Peptidase_M20 | 1.00 |
| PF01627 | Hpt | 1.00 |
| PF00665 | rve | 1.00 |
| PF00355 | Rieske | 1.00 |
| PF01594 | AI-2E_transport | 1.00 |
| PF00296 | Bac_luciferase | 1.00 |
| PF13683 | rve_3 | 1.00 |
| PF07690 | MFS_1 | 1.00 |
| PF13378 | MR_MLE_C | 1.00 |
| PF03793 | PASTA | 1.00 |
| PF08543 | Phos_pyr_kin | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 23.00 |
| COG0351 | Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase | Coenzyme transport and metabolism [H] | 1.00 |
| COG0524 | Sugar or nucleoside kinase, ribokinase family | Carbohydrate transport and metabolism [G] | 1.00 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 1.00 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.00 |
| COG2240 | Pyridoxal/pyridoxine/pyridoxamine kinase | Coenzyme transport and metabolism [H] | 1.00 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 1.00 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 1.00 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 1.00 |
| COG2870 | ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase | Cell wall/membrane/envelope biogenesis [M] | 1.00 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 1.00 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.00 % |
| Unclassified | root | N/A | 2.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001431|F14TB_101448527 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300002558|JGI25385J37094_10003450 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5417 | Open in IMG/M |
| 3300002560|JGI25383J37093_10000614 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8800 | Open in IMG/M |
| 3300002561|JGI25384J37096_10006959 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4209 | Open in IMG/M |
| 3300002561|JGI25384J37096_10022401 | All Organisms → cellular organisms → Bacteria | 2462 | Open in IMG/M |
| 3300002562|JGI25382J37095_10005539 | All Organisms → cellular organisms → Bacteria | 4480 | Open in IMG/M |
| 3300005177|Ga0066690_11024616 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 517 | Open in IMG/M |
| 3300005180|Ga0066685_10087827 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2061 | Open in IMG/M |
| 3300005181|Ga0066678_10655415 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 699 | Open in IMG/M |
| 3300005181|Ga0066678_11103038 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 510 | Open in IMG/M |
| 3300005441|Ga0070700_100369584 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1069 | Open in IMG/M |
| 3300005446|Ga0066686_11001879 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 542 | Open in IMG/M |
| 3300005454|Ga0066687_10396154 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 798 | Open in IMG/M |
| 3300005459|Ga0068867_100474853 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300005468|Ga0070707_100252172 | All Organisms → cellular organisms → Bacteria | 1717 | Open in IMG/M |
| 3300005468|Ga0070707_100376870 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
| 3300005540|Ga0066697_10705905 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 552 | Open in IMG/M |
| 3300005546|Ga0070696_100573737 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300005546|Ga0070696_100593008 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300005546|Ga0070696_101779778 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 532 | Open in IMG/M |
| 3300005552|Ga0066701_10411494 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 837 | Open in IMG/M |
| 3300005555|Ga0066692_10449952 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 820 | Open in IMG/M |
| 3300005555|Ga0066692_10560444 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 721 | Open in IMG/M |
| 3300005557|Ga0066704_10667979 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 658 | Open in IMG/M |
| 3300005557|Ga0066704_10941795 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 533 | Open in IMG/M |
| 3300005559|Ga0066700_10935969 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 574 | Open in IMG/M |
| 3300005578|Ga0068854_101614295 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300005586|Ga0066691_10607336 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300005764|Ga0066903_102559379 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 989 | Open in IMG/M |
| 3300005844|Ga0068862_100756394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Sedimenticola → Sedimenticola thiotaurini | 946 | Open in IMG/M |
| 3300005981|Ga0081538_10315390 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 571 | Open in IMG/M |
| 3300006034|Ga0066656_10431760 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300006574|Ga0074056_10872613 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 729 | Open in IMG/M |
| 3300006794|Ga0066658_10834766 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300006796|Ga0066665_11667532 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 504 | Open in IMG/M |
| 3300006797|Ga0066659_11668876 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300006844|Ga0075428_100949710 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300006846|Ga0075430_101164871 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 635 | Open in IMG/M |
| 3300006847|Ga0075431_101433461 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 650 | Open in IMG/M |
| 3300006854|Ga0075425_101291341 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300007255|Ga0099791_10424211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 642 | Open in IMG/M |
| 3300009088|Ga0099830_10089374 | All Organisms → cellular organisms → Bacteria | 2277 | Open in IMG/M |
| 3300009147|Ga0114129_12545012 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 611 | Open in IMG/M |
| 3300009156|Ga0111538_10657299 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1329 | Open in IMG/M |
| 3300009157|Ga0105092_10305482 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 898 | Open in IMG/M |
| 3300010329|Ga0134111_10303848 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 665 | Open in IMG/M |
| 3300010379|Ga0136449_103839965 | Not Available | 564 | Open in IMG/M |
| 3300010398|Ga0126383_13192345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300010401|Ga0134121_10988784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Sedimenticola → Sedimenticola thiotaurini | 825 | Open in IMG/M |
| 3300011270|Ga0137391_10071650 | All Organisms → cellular organisms → Bacteria | 2979 | Open in IMG/M |
| 3300011270|Ga0137391_10519731 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1006 | Open in IMG/M |
| 3300011443|Ga0137457_1351020 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 503 | Open in IMG/M |
| 3300012203|Ga0137399_11400384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 585 | Open in IMG/M |
| 3300012208|Ga0137376_11373489 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 597 | Open in IMG/M |
| 3300012355|Ga0137369_10059004 | All Organisms → cellular organisms → Bacteria | 3306 | Open in IMG/M |
| 3300012360|Ga0137375_10361087 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1285 | Open in IMG/M |
| 3300012685|Ga0137397_10382071 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300012918|Ga0137396_10234590 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
| 3300012918|Ga0137396_10740541 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300012922|Ga0137394_11148064 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 641 | Open in IMG/M |
| 3300012922|Ga0137394_11332310 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 580 | Open in IMG/M |
| 3300014154|Ga0134075_10122726 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
| 3300014501|Ga0182024_10341005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1962 | Open in IMG/M |
| 3300015251|Ga0180070_1068247 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 504 | Open in IMG/M |
| 3300018469|Ga0190270_12733713 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 556 | Open in IMG/M |
| 3300019882|Ga0193713_1057625 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300020004|Ga0193755_1054431 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
| 3300020221|Ga0194127_10177591 | All Organisms → cellular organisms → Bacteria | 1509 | Open in IMG/M |
| 3300022534|Ga0224452_1082396 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| (restricted) 3300023208|Ga0233424_10080901 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1437 | Open in IMG/M |
| 3300026075|Ga0207708_10619698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 918 | Open in IMG/M |
| 3300026295|Ga0209234_1128363 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300026335|Ga0209804_1038701 | All Organisms → cellular organisms → Bacteria | 2382 | Open in IMG/M |
| 3300026351|Ga0257170_1010805 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1130 | Open in IMG/M |
| 3300026360|Ga0257173_1003966 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1445 | Open in IMG/M |
| 3300026497|Ga0257164_1014331 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300026514|Ga0257168_1152257 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 515 | Open in IMG/M |
| 3300026524|Ga0209690_1038965 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2213 | Open in IMG/M |
| 3300026538|Ga0209056_10442561 | Not Available | 750 | Open in IMG/M |
| 3300026538|Ga0209056_10620234 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 545 | Open in IMG/M |
| 3300027637|Ga0209818_1088897 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 803 | Open in IMG/M |
| 3300027655|Ga0209388_1160606 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 633 | Open in IMG/M |
| 3300027722|Ga0209819_10277437 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 579 | Open in IMG/M |
| 3300027821|Ga0209811_10081029 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300027880|Ga0209481_10109043 | All Organisms → cellular organisms → Bacteria | 1343 | Open in IMG/M |
| 3300027905|Ga0209415_10089459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3465 | Open in IMG/M |
| 3300027909|Ga0209382_11958018 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 564 | Open in IMG/M |
| 3300028673|Ga0257175_1010002 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
| 3300028673|Ga0257175_1015555 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1211 | Open in IMG/M |
| 3300031226|Ga0307497_10025446 | All Organisms → cellular organisms → Bacteria | 1876 | Open in IMG/M |
| 3300031548|Ga0307408_100786272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 862 | Open in IMG/M |
| 3300031720|Ga0307469_11482386 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300031720|Ga0307469_11684986 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 611 | Open in IMG/M |
| 3300031908|Ga0310900_10063573 | All Organisms → cellular organisms → Bacteria | 2226 | Open in IMG/M |
| 3300032174|Ga0307470_11768206 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 522 | Open in IMG/M |
| 3300032180|Ga0307471_101628217 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 801 | Open in IMG/M |
| 3300032180|Ga0307471_102444127 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 660 | Open in IMG/M |
| 3300032205|Ga0307472_100166863 | All Organisms → cellular organisms → Bacteria | 1631 | Open in IMG/M |
| 3300032205|Ga0307472_101110562 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 749 | Open in IMG/M |
| 3300033433|Ga0326726_12026716 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 560 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 22.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.00% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.00% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.00% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.00% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.00% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.00% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.00% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015251 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293_16_10D | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300023208 (restricted) | Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_125_MG | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
| 3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027637 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TB_1014485271 | 3300001431 | Soil | VNKNIRLLYGFSFFDPFMIVIPVWVPYLATQGITMRQFMELQ |
| JGI25385J37094_100034501 | 3300002558 | Grasslands Soil | VNRNIKLLYGFSFFDQFMIVIALWVPYLATKGIGMRQFMELQAVF |
| JGI25383J37093_100006149 | 3300002560 | Grasslands Soil | VNRNIKLLYGFSFFDQFMIVIALWVPYLATKGIGMRQFMELQ |
| JGI25384J37096_100069591 | 3300002561 | Grasslands Soil | VNRNIKLLYGFSFFDQFMIVIALWVPYLATKGIGMRQFMELQAVFA |
| JGI25384J37096_100224011 | 3300002561 | Grasslands Soil | VNRNIKLLYGFSCFDQFMIVIALWVPYLATKGIGMRQFMELQAVFA |
| JGI25382J37095_100055391 | 3300002562 | Grasslands Soil | VNRNIKLLYGFSFFDQFMIVIALWVPYLATKGIGMRQFMEL |
| Ga0066690_110246162 | 3300005177 | Soil | VKKNIALLYGFSFFDQFMIVIALWVPYLTTQGISMRQFMELQ |
| Ga0066685_100878271 | 3300005180 | Soil | MSNGHDGPAPVEKNIALLYGFSFFDQFMIVIALWVPYLTTQGISMRQFMELQ |
| Ga0066678_106554152 | 3300005181 | Soil | VKRNIALLYGFSFFDQFMIVIALWVPYLTTQGIGMRQFMELQAVFALVILC |
| Ga0066678_111030381 | 3300005181 | Soil | VKKNIALLYGFSFFDQFMIVIALWIPYLTTQGISMRQFMELQ |
| Ga0070700_1003695842 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | VAVKKNIPLLYGFSFFDQFMIVIPVWVPYLASQGINMRQFMELQAGFALVILCGEV |
| Ga0066686_110018791 | 3300005446 | Soil | VKKNIKLLYGFSFFDQFMIVIALWVPYLATKGIGMRQFMELQAVFALVILC |
| Ga0066687_103961541 | 3300005454 | Soil | VKRNIALLYGFSFFDQFMIVIALWVPYLTAQGISMRQFMELQAMFALVILAGEVPS |
| Ga0068867_1004748533 | 3300005459 | Miscanthus Rhizosphere | VKQNIKLLYGFSFFDQFMIVIALWIPYLTTQGISMRQFMELQ |
| Ga0070707_1002521721 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VKKNIALLYGFSFSDQFMIVIALWVPYLTTQGISMRQFMEL |
| Ga0070707_1003768701 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNGHDGPAPVKKNIALLYGFSFFDQFMIVIALWVPYLTTQGISMRQFMELQAVFALVIL |
| Ga0066697_107059052 | 3300005540 | Soil | VNTNIRLLYGFSFFDPFMIVIPVWVPYLATLGITMRQFMELQAVFALVILCGE |
| Ga0070696_1005737373 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VNRNIKLLYGFAFFDQFMIVIALWIPYLTTQGITMRQFMELQAVF |
| Ga0070696_1005930081 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | LKKNLALLYGFSFFDQFMIVIALWVPYLATQGIGMRQFMELQAVFAIVILSGE |
| Ga0070696_1017797782 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VAVKKNIPLLYGFSFFDQFMIVIPVWVPYLATQGINMRQFMELQA |
| Ga0066701_104114941 | 3300005552 | Soil | VKKNIALLYGFSFFDQFMIVIALWVPYLTTQGISMRQFM |
| Ga0066692_104499522 | 3300005555 | Soil | VNTNIRLLYGFSFFDPFMIVIPVWVPYLLTQGITMRQFMEL |
| Ga0066692_105604443 | 3300005555 | Soil | VKKNIALLYGFSFFDQFMIVIALWIPYLTTQGISMRQFMELQAVFA |
| Ga0066704_106679793 | 3300005557 | Soil | LKKNIALLYGFSFFDQFMIVIALWVPYLATKGIGMRQFM |
| Ga0066704_109417951 | 3300005557 | Soil | VKKNIALLYGFSFFDQFMIVIALWVPYLTTQGISM |
| Ga0066700_109359692 | 3300005559 | Soil | VNTNIKLLYGFSFFDPFMIVIPVWVSYLATQGRPAIRRP |
| Ga0068854_1016142951 | 3300005578 | Corn Rhizosphere | LKKNLALLYGFSFFDQFMIVIALWVPYLATQGIGMRQFMELQAVFALV |
| Ga0066691_106073362 | 3300005586 | Soil | VKKNIALLYGFSFFDQFMIVIALWIPYLTTQGISMRQFMELQA |
| Ga0066903_1025593791 | 3300005764 | Tropical Forest Soil | MHAAVKKNIPLLYGFAFVDQCMIVIAVWVPYLATQGIGMRQFMELQAV |
| Ga0068862_1007563942 | 3300005844 | Switchgrass Rhizosphere | VAVKKNIPLLYGFSFFDQFMIVIPVWVPYLATQGINM |
| Ga0081538_103153902 | 3300005981 | Tabebuia Heterophylla Rhizosphere | VNTNIRLLYGFSFFDPFMIVIPLWVPYLATQGITMRQFMELQALFAI |
| Ga0066656_104317601 | 3300006034 | Soil | VNRNIKLLYGFSCFDQFMIVIALWVPYLATKGIGMRQFMELQAVFALVILCGE |
| Ga0074056_108726131 | 3300006574 | Soil | VKKNIALLYGFSFFDQFMIVIALWVPYLATKGIGMRQFME |
| Ga0066658_108347662 | 3300006794 | Soil | VTRNIKLLYGFSFFDQFMIVIALWVPYLATKGIGMRQFMELQ |
| Ga0066665_116675323 | 3300006796 | Soil | VKKNIALLYGFSFFDQFMIVIALWVPYLTTQGISMRQF |
| Ga0066659_116688761 | 3300006797 | Soil | VKKNIALLYGFSFFDQFMIVIALWVPYLTTQGISMRQFMELQA |
| Ga0075428_1009497101 | 3300006844 | Populus Rhizosphere | VNRNVKLLYGFSFFDQFMIVIALWIPYLTTQGIAMRQFMELQAVFAIVILS |
| Ga0075430_1011648712 | 3300006846 | Populus Rhizosphere | MKKNIPLLYGFTFFDQFMIVIALWVPYLTTQGISMRQFMELQAVF |
| Ga0075431_1014334611 | 3300006847 | Populus Rhizosphere | VKKNVALLYGFSFLDQFMIVIALWVPYLATLGIGMRQFMELQAVFAIVIL |
| Ga0075425_1012913413 | 3300006854 | Populus Rhizosphere | VNRNVKLLYGFSFFDQFMIVIALWIPYLTTQGITMRQFMELQAVFAIVILSGEV |
| Ga0099791_104242112 | 3300007255 | Vadose Zone Soil | VKRNIALLYGFSFFDQFMIVIALWIPYLTTQGISMRQFMELQAIFAIVILCG |
| Ga0099830_100893743 | 3300009088 | Vadose Zone Soil | VKKNITLLYGFSFFDQFMIVIALWVPYLATQGIGMRQFMELQAVFALVPGGPAGWSCSG* |
| Ga0114129_125450122 | 3300009147 | Populus Rhizosphere | VNRNIKLLYGFSFFDQFMIVIALWIPYLTTQGITMRQFMELQAVFAIVIL |
| Ga0111538_106572992 | 3300009156 | Populus Rhizosphere | MKKNIALLYGFSFFDQFMILIALWVPYLATQGIGMRQFMELQAVFALVIL* |
| Ga0105092_103054823 | 3300009157 | Freshwater Sediment | VNKNIKLLYGFSFFDQFMIVIALWVPYLATKGIGMRQFMELQ |
| Ga0134111_103038482 | 3300010329 | Grasslands Soil | VNRNIKLLYGFSFFDQFMIVIALWIPYLTTQGITMRQ |
| Ga0136449_1038399651 | 3300010379 | Peatlands Soil | VKNNIRLLYGFSFFDQFMIVIPLLVPYLATKGIGM |
| Ga0126383_131923451 | 3300010398 | Tropical Forest Soil | MHAAVKKNIPLLYGFAFVDQCMIVIAVWVPYLATQGIGMRQFMELQAVFAIVILCGEV |
| Ga0134121_109887841 | 3300010401 | Terrestrial Soil | VAVKKNILLLYGFSFFDQFMIVIPVWVPYLATQGINMRQFMEL |
| Ga0137391_100716501 | 3300011270 | Vadose Zone Soil | VKKNITLLYGFSFFDQFMIVIALWVPYLATQGIGMRQFMELQAVFALV |
| Ga0137391_105197312 | 3300011270 | Vadose Zone Soil | VKKSIALLYGFSFFDQFMIVIALWVPYLTAQGISMRQFMEMQ |
| Ga0137457_13510201 | 3300011443 | Soil | VKKNITLLYGFSFFDQFMIVIALWVPYLATKGIGMRQFMELQAVFA |
| Ga0137399_114003841 | 3300012203 | Vadose Zone Soil | VNRNIKLLYGFSFFDQFMIVIALWVPYLATKGIGMRQFME |
| Ga0137376_113734893 | 3300012208 | Vadose Zone Soil | VKRNIALLYGFSFFDQFMIVIALWVPYLTAQGISMRQFM |
| Ga0137369_100590045 | 3300012355 | Vadose Zone Soil | VKRNIPLLYGFSFFDQFMIVIALWVPYLTTQGISMR* |
| Ga0137375_103610871 | 3300012360 | Vadose Zone Soil | VKKNITLLYGFSCFDQFMIVIALWVPYLATKGIGMR |
| Ga0137397_103820713 | 3300012685 | Vadose Zone Soil | VKKNIPLLYGFSFFDQFMIVIALWVPYLTTQGISMRQFM |
| Ga0137396_102345901 | 3300012918 | Vadose Zone Soil | VKKNIKLLYGFSFFDQFMIVIALWVPYLATKGIGMRQFMEL |
| Ga0137396_107405413 | 3300012918 | Vadose Zone Soil | LKKNIALLYGFSFFDQFMIVIALWVPYLATKGIGMRQFMELQ |
| Ga0137394_111480642 | 3300012922 | Vadose Zone Soil | VKKNIPLLYGFSFFDQFMIVIALWVPYLATKGIGMRQFM |
| Ga0137394_113323101 | 3300012922 | Vadose Zone Soil | VNTNIRLLYGFSFFDPFMIVIPMWVPYLATLGITMRQFMELQAVFALVIL |
| Ga0134075_101227263 | 3300014154 | Grasslands Soil | VNRNIKLLYGFSCFDQFMIVIALWVPYLATKGIGMRQFMELQAVFALVIL |
| Ga0182024_103410051 | 3300014501 | Permafrost | VIGRVKNNIRLLYGFSFFDQFMIVIPLLVPYLATKGISMAQFM |
| Ga0180070_10682471 | 3300015251 | Soil | VKKNIALLYGFSFFDQFMIVIALWVPYLATKGIGMR* |
| Ga0190270_127337132 | 3300018469 | Soil | VKRNIKLLYGFSFFDQFMIVIALWVPYLATQGIGMRQFMELQAVFAVVILCG |
| Ga0193713_10576253 | 3300019882 | Soil | VNENIALLYGFSFFDQFMIVIALWVPYLATKGIGMRQFMELQAVFALVIL |
| Ga0193755_10544313 | 3300020004 | Soil | MKRNIPLLYGFSCFDQFMIVIAVWVPYLATQGIGISLAQL |
| Ga0194127_101775911 | 3300020221 | Freshwater Lake | VNRNVKLLYSFSFFNPFMIVIPLWVPYLATHGITMR |
| Ga0224452_10823961 | 3300022534 | Groundwater Sediment | VKKNIALLYGFSFFDQFMIVIALWVPYLTTQGVSMRQFMELQ |
| (restricted) Ga0233424_100809012 | 3300023208 | Freshwater | LKKNIKLLYGFSFFDQFMIVIPLLVPYLGTKEIGMGQFMEL |
| Ga0207708_106196982 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | VAVKKNIPLLYGFSFFDQFMIVIPVWVPYLASQGINMRQFMELQAGFALVILCGEVPTG |
| Ga0209234_11283631 | 3300026295 | Grasslands Soil | VNRNIKLLYGFSCFDQFMIVIALWVPYLATKGIGM |
| Ga0209804_10387011 | 3300026335 | Soil | MTKNIPLLYGFSFFDQFMIVIASWVPYLATQGIGMRQ |
| Ga0257170_10108052 | 3300026351 | Soil | VKKNITLLYGFSFFDQFMIVIALWVPYLATQGIGMRQFMELQAVFALVPGGPAGWSCSG |
| Ga0257173_10039664 | 3300026360 | Soil | VKKNITLLYGFSFFDQFMIVIALWVPYLATQGIGMRQFMELQAVFALVPG |
| Ga0257164_10143311 | 3300026497 | Soil | VKKNITLLYGFSFFDQFMIVIALWVPYLATQGIGMRQFMELQAVFALVPGGPAG |
| Ga0257168_11522571 | 3300026514 | Soil | AVAAVNRNINLLYGFSFFDPFMIVIPVFVPYLATNGISMRQFMELQDAS |
| Ga0209690_10389651 | 3300026524 | Soil | MSNGHDGPAPVKKNIALLYGFSFFDQFMIVIALWVPYLATQGISMRQFMELQAVFA |
| Ga0209056_104425611 | 3300026538 | Soil | VKNNIALLYGFSFFDQFMIVIALWIPYLATQGISMRQFMELQA |
| Ga0209056_106202341 | 3300026538 | Soil | VKKNIALLYGFSFFDQFMIVIALWVPYLTTQGISMRQFMELQAVF |
| Ga0209818_10888971 | 3300027637 | Agricultural Soil | MKKNIPLLYGFSFFDQFMIVIALWVPYLATQGISMRQFM |
| Ga0209388_11606062 | 3300027655 | Vadose Zone Soil | VNRNIKLLYGFSFFDQFMIVIALWVPYLATKGIGMRQFMELQAVFAIV |
| Ga0209819_102774372 | 3300027722 | Freshwater Sediment | VNKNIKLLYGFSFFDQFMIVIALWVPYLATKGIGMRQFMELQAMF |
| Ga0209811_100810291 | 3300027821 | Surface Soil | VNRNIKLLYGFAFFDQFMIVIALWIPYLTTQGITMRQFMELQAVFAIVI |
| Ga0209481_101090433 | 3300027880 | Populus Rhizosphere | MKKNIALLYGFSFFDQFMILIALWVPYLATQGIGMRQFMELQAVFALV |
| Ga0209415_100894594 | 3300027905 | Peatlands Soil | VKNNLRLLYGFSFVDQFMIVIPLWVPYLATKGISMAQFMQLQAIFALVIV |
| Ga0209382_119580181 | 3300027909 | Populus Rhizosphere | LKKNLALLYGFSFFDQFMIVIALWVPYLATQGIGMRQFMELQAVFALVIL |
| Ga0257175_10100023 | 3300028673 | Soil | VKKNITLLYGFSFFDQFMIVIALWVPYLATHGIGMR |
| Ga0257175_10155551 | 3300028673 | Soil | RHPGRSPGLRPVKKNITLLYGFSFFDQFMIVIALWVPYLATQGIGMRQFMELQAVFALVPGGPAGWSCSG |
| Ga0307497_100254461 | 3300031226 | Soil | VNRNIKLLYGFSFFDQFMIVIALWIPYLTTQGITMRQFME |
| Ga0307408_1007862721 | 3300031548 | Rhizosphere | VKKNIPLLYGFSFFDQFMIVIALWVPYLATQGISM |
| Ga0307469_114823863 | 3300031720 | Hardwood Forest Soil | MKRNISLLYGFSFFDQFMIVIALWVPYLAAQGIGMRQFMELQAVFAIV |
| Ga0307469_116849861 | 3300031720 | Hardwood Forest Soil | VKKNIALLYGFSFLDQFMIVIALWVPYLATKGIGMRQFMEL |
| Ga0310900_100635731 | 3300031908 | Soil | VKQNIKLLYGFSFFDQFMIVIALWIPYLTTQGISMRQFMEL |
| Ga0307470_117682061 | 3300032174 | Hardwood Forest Soil | VNRNIKLLYGFSFFDPFMIVIPVWVPYLATQGITMRQFMELQA |
| Ga0307471_1016282171 | 3300032180 | Hardwood Forest Soil | VNRNIKLLYGFSFFDQFMNVIALWVPYLATKGIGMR |
| Ga0307471_1024441271 | 3300032180 | Hardwood Forest Soil | VKKNIALLYGFSFFDQFMIVIALWVPYLTTQGMSMRQFMEL |
| Ga0307472_1001668634 | 3300032205 | Hardwood Forest Soil | VNKNVRLLYGFSFFDPFMIVIPVWVPYLATQGITMRQF |
| Ga0307472_1011105622 | 3300032205 | Hardwood Forest Soil | MTKNIPLLYGFSFFDQFMIHIAVWVPYLTTQGIGMRQFMELQAAFALVILCGE |
| Ga0326726_120267162 | 3300033433 | Peat Soil | VKKNIALLYGFSFFDQFMIVIALWVPYLATKGIGMRQFM |
| ⦗Top⦘ |