


| Basic Information | |
|---|---|
| Family ID | F106046 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 43 residues |
| Representative Sequence | VNDNVRYWIATAPVGAASVLAEELAQFGASDIRERSHDVKFQ |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 29.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.00 % |
| % of genes from short scaffolds (< 2000 bps) | 95.00 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 12.86% β-sheet: 0.00% Coil/Unstructured: 87.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF01541 | GIY-YIG | 10.00 |
| PF06181 | Urate_ox_N | 10.00 |
| PF00929 | RNase_T | 7.00 |
| PF00795 | CN_hydrolase | 2.00 |
| PF00892 | EamA | 1.00 |
| PF00753 | Lactamase_B | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG3748 | Uncharacterized membrane protein | Function unknown [S] | 10.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.00 % |
| Unclassified | root | N/A | 27.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10369244 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 874 | Open in IMG/M |
| 3300001593|JGI12635J15846_10848413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 522 | Open in IMG/M |
| 3300001661|JGI12053J15887_10276718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 827 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10181829 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 852 | Open in IMG/M |
| 3300004092|Ga0062389_104284564 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 537 | Open in IMG/M |
| 3300004152|Ga0062386_100181471 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1651 | Open in IMG/M |
| 3300004635|Ga0062388_100685460 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 954 | Open in IMG/M |
| 3300005541|Ga0070733_10715588 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 672 | Open in IMG/M |
| 3300005950|Ga0066787_10036171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 909 | Open in IMG/M |
| 3300005994|Ga0066789_10237146 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 766 | Open in IMG/M |
| 3300005995|Ga0066790_10419514 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 572 | Open in IMG/M |
| 3300006052|Ga0075029_100975168 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 584 | Open in IMG/M |
| 3300009634|Ga0116124_1099593 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300009660|Ga0105854_1153266 | Not Available | 745 | Open in IMG/M |
| 3300009697|Ga0116231_10159661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1309 | Open in IMG/M |
| 3300009701|Ga0116228_10495676 | Not Available | 836 | Open in IMG/M |
| 3300009701|Ga0116228_10861048 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 606 | Open in IMG/M |
| 3300009709|Ga0116227_10178293 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1661 | Open in IMG/M |
| 3300009709|Ga0116227_10962772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-14 | 642 | Open in IMG/M |
| 3300010159|Ga0099796_10196801 | Not Available | 816 | Open in IMG/M |
| 3300010386|Ga0136806_1192468 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 802 | Open in IMG/M |
| 3300011106|Ga0151489_1460689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-14 | 540 | Open in IMG/M |
| 3300011269|Ga0137392_10569330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 941 | Open in IMG/M |
| 3300012203|Ga0137399_10455970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1070 | Open in IMG/M |
| 3300012359|Ga0137385_11025548 | Not Available | 680 | Open in IMG/M |
| 3300012924|Ga0137413_10293104 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1134 | Open in IMG/M |
| 3300014168|Ga0181534_10890059 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 532 | Open in IMG/M |
| 3300014493|Ga0182016_10585928 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 636 | Open in IMG/M |
| 3300014498|Ga0182019_11406747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Halofilum → Halofilum ochraceum | 517 | Open in IMG/M |
| 3300014657|Ga0181522_10761621 | Not Available | 593 | Open in IMG/M |
| 3300014658|Ga0181519_11068826 | Not Available | 502 | Open in IMG/M |
| 3300015242|Ga0137412_10557747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 871 | Open in IMG/M |
| 3300017946|Ga0187879_10119554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1503 | Open in IMG/M |
| 3300020199|Ga0179592_10039213 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2146 | Open in IMG/M |
| 3300020199|Ga0179592_10232416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 831 | Open in IMG/M |
| 3300020579|Ga0210407_11182310 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 576 | Open in IMG/M |
| 3300020580|Ga0210403_10197530 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1650 | Open in IMG/M |
| 3300020581|Ga0210399_10544581 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300020583|Ga0210401_11351178 | Not Available | 570 | Open in IMG/M |
| 3300021168|Ga0210406_10708596 | Not Available | 775 | Open in IMG/M |
| 3300021168|Ga0210406_10933713 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 650 | Open in IMG/M |
| 3300021170|Ga0210400_10674235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 851 | Open in IMG/M |
| 3300021180|Ga0210396_10854204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-14 | 778 | Open in IMG/M |
| 3300021181|Ga0210388_10000627 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 28262 | Open in IMG/M |
| 3300021181|Ga0210388_10759929 | Not Available | 842 | Open in IMG/M |
| 3300021404|Ga0210389_10701794 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300021405|Ga0210387_10171640 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1868 | Open in IMG/M |
| 3300021407|Ga0210383_10274712 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1447 | Open in IMG/M |
| 3300021474|Ga0210390_10397919 | Not Available | 1164 | Open in IMG/M |
| 3300021477|Ga0210398_10514354 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 974 | Open in IMG/M |
| 3300021479|Ga0210410_10526106 | Not Available | 1055 | Open in IMG/M |
| 3300024176|Ga0224565_1047702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-14 | 503 | Open in IMG/M |
| 3300024187|Ga0247672_1090424 | Not Available | 532 | Open in IMG/M |
| 3300024283|Ga0247670_1066663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 654 | Open in IMG/M |
| 3300024288|Ga0179589_10037673 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1747 | Open in IMG/M |
| 3300026291|Ga0209890_10139670 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 812 | Open in IMG/M |
| 3300026294|Ga0209839_10240311 | Not Available | 571 | Open in IMG/M |
| 3300026304|Ga0209240_1093943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1085 | Open in IMG/M |
| 3300026557|Ga0179587_10063926 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2151 | Open in IMG/M |
| 3300026557|Ga0179587_10946227 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300027496|Ga0208987_1075662 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 612 | Open in IMG/M |
| 3300027660|Ga0209736_1070225 | Not Available | 973 | Open in IMG/M |
| 3300027663|Ga0208990_1190957 | Not Available | 524 | Open in IMG/M |
| 3300027696|Ga0208696_1210980 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 613 | Open in IMG/M |
| 3300027737|Ga0209038_10250606 | Not Available | 531 | Open in IMG/M |
| 3300027807|Ga0209208_10508061 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 561 | Open in IMG/M |
| 3300027824|Ga0209040_10529189 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 517 | Open in IMG/M |
| 3300027860|Ga0209611_10214214 | Not Available | 1170 | Open in IMG/M |
| 3300027860|Ga0209611_10575385 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 624 | Open in IMG/M |
| 3300027879|Ga0209169_10756042 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 502 | Open in IMG/M |
| 3300027884|Ga0209275_10040923 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2185 | Open in IMG/M |
| 3300027911|Ga0209698_11128067 | Not Available | 580 | Open in IMG/M |
| 3300028562|Ga0302151_10286943 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 547 | Open in IMG/M |
| 3300028783|Ga0302279_10242498 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 822 | Open in IMG/M |
| 3300028808|Ga0302228_10099661 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1361 | Open in IMG/M |
| 3300028813|Ga0302157_10290457 | Not Available | 898 | Open in IMG/M |
| 3300028813|Ga0302157_10406038 | Not Available | 725 | Open in IMG/M |
| 3300029922|Ga0311363_11100356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 683 | Open in IMG/M |
| 3300029953|Ga0311343_10442790 | Not Available | 1178 | Open in IMG/M |
| 3300029999|Ga0311339_10487630 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1258 | Open in IMG/M |
| 3300029999|Ga0311339_11147771 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 715 | Open in IMG/M |
| 3300030046|Ga0302305_1173369 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 799 | Open in IMG/M |
| 3300030399|Ga0311353_11473796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-14 | 552 | Open in IMG/M |
| 3300030519|Ga0302193_10187500 | Not Available | 1168 | Open in IMG/M |
| 3300030520|Ga0311372_11508749 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 828 | Open in IMG/M |
| 3300030813|Ga0265750_1050122 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300031057|Ga0170834_109514828 | Not Available | 558 | Open in IMG/M |
| 3300031231|Ga0170824_111353977 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 830 | Open in IMG/M |
| 3300031236|Ga0302324_101892885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 754 | Open in IMG/M |
| 3300031236|Ga0302324_103438850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 515 | Open in IMG/M |
| 3300031258|Ga0302318_10540469 | Not Available | 590 | Open in IMG/M |
| 3300031524|Ga0302320_11984317 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 546 | Open in IMG/M |
| 3300031708|Ga0310686_107488442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1447 | Open in IMG/M |
| 3300031715|Ga0307476_10436123 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 969 | Open in IMG/M |
| 3300031718|Ga0307474_11502248 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 530 | Open in IMG/M |
| 3300031753|Ga0307477_11000474 | Not Available | 549 | Open in IMG/M |
| 3300031823|Ga0307478_10626938 | Not Available | 900 | Open in IMG/M |
| 3300031837|Ga0302315_10176771 | Not Available | 1303 | Open in IMG/M |
| 3300031962|Ga0307479_10176260 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2102 | Open in IMG/M |
| 3300032160|Ga0311301_11855767 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 714 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.00% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 9.00% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 8.00% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 8.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.00% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 5.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 5.00% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.00% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.00% |
| Sediment | Environmental → Aquatic → Freshwater → Groundwater → Mine Drainage → Sediment | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.00% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.00% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.00% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.00% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.00% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
| 3300009660 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058 | Environmental | Open in IMG/M |
| 3300009697 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009701 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300009709 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010386 | Acid mine drainage microbial communities from Malanjkhand copper mine, India - M8 kmer 63 | Environmental | Open in IMG/M |
| 3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300024176 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1 | Environmental | Open in IMG/M |
| 3300024187 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13 | Environmental | Open in IMG/M |
| 3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027496 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027807 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027860 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028562 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_3 | Environmental | Open in IMG/M |
| 3300028783 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028813 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030046 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_3 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030519 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_3 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030813 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031258 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1 | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031837 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_103692441 | 3300001593 | Forest Soil | VNDNVRYWIATAPVGAASVLAEELVQFGAHDVRER |
| JGI12635J15846_108484131 | 3300001593 | Forest Soil | LSANDNVRYWIATAPVGAASVLAEELAQFGAEDIRERSHDVKFQ |
| JGI12053J15887_102767182 | 3300001661 | Forest Soil | VNGNVRYWIATAPVGAASVLAEELALFGAHDVRERSHDVKF |
| JGIcombinedJ51221_101818291 | 3300003505 | Forest Soil | VSEDVRYWIATAPIGAASVLAEELERFGASDIRERSHDVKFQ |
| Ga0062389_1042845641 | 3300004092 | Bog Forest Soil | MSPERDDNVRYWIATAPVGAASVLAEELAQLGASDIRERSHDVRF |
| Ga0062386_1001814712 | 3300004152 | Bog Forest Soil | VTGNVRYWIATAPIGAASVLAEELAQIGATDIRERSHDVKF |
| Ga0062388_1006854602 | 3300004635 | Bog Forest Soil | VSEDVRYWIATAPIGAASVLAEELQQFGASDIRERSHDVK |
| Ga0070733_107155882 | 3300005541 | Surface Soil | MNDNVRYWVATAPVGAASVLAEELVHFGAEQIRERSHDVKFQGTLEV |
| Ga0066787_100361712 | 3300005950 | Soil | VSDNVRYWIATAPVGAASVLAEELRQFGAEDIRERSHDVK |
| Ga0066789_102371462 | 3300005994 | Soil | VNDNVRYWIATAPVGAASVLAEELAQFGAHDIRERSHDVKFQGTLEVGYRA |
| Ga0066790_104195142 | 3300005995 | Soil | VSDNVRYWIATAPVGAASVLAEELAQFGATDIRERSHDVKFQGT |
| Ga0075029_1009751682 | 3300006052 | Watersheds | VTDNVLYWIATAPVGAASVLAEELAGLGASDLRERSNDVKFQ |
| Ga0116124_10995932 | 3300009634 | Peatland | VSDNVRYWIATAPIGAASVLAEELLQYGASGIRERSNDVKF* |
| Ga0105854_11532662 | 3300009660 | Permafrost Soil | VNDNVRYWIATAPVGAASVLAEELKQFGAEDIRERSHDVKFQGTLEVGYRT |
| Ga0116231_101596612 | 3300009697 | Host-Associated | LGGIPLPVSDDIRYWVATAPVGAASVLTAELLEFGASDVRERSIDVKFQGSL |
| Ga0116228_104956761 | 3300009701 | Host-Associated | LSANIQYWIATAPVGAASVLAQELAAFGASEVRER |
| Ga0116228_108610482 | 3300009701 | Host-Associated | LSDIPNVRYWIATAPVGAASVLAEELAQFGATDIRERSHDVKFQGTLETG |
| Ga0116227_101782931 | 3300009709 | Host-Associated | MTDNVRYWIATAPVGAASVLAGELAQFGATDIRERSHDVKFQGTLE |
| Ga0116227_109627722 | 3300009709 | Host-Associated | MDNVRYWIATAPIGAASVLAEELVSFGATDIRERSHDVKFQGT |
| Ga0099796_101968011 | 3300010159 | Vadose Zone Soil | VSDNVRYWIATAPVGAASVLAEELAAFGASDIRERSHDVKFQGTLDVG |
| Ga0136806_11924682 | 3300010386 | Sediment | VSAERRSWIATAPIGAASVLAEELAPFGASAVRERSSDXXXXXXX |
| Ga0151489_14606892 | 3300011106 | Soil | VNDNVRYWIATAPVGAASVLAEELAQFGAADIRERSHD |
| Ga0137392_105693301 | 3300011269 | Vadose Zone Soil | VNDNVRYWIATAPVGAASVLAEELAQFGAHDVRERSHDVK |
| Ga0137399_104559702 | 3300012203 | Vadose Zone Soil | VNDNVRYWIATAPVGAASVLAEELAQFGAHDIRERSHDVKFQ |
| Ga0137385_110255482 | 3300012359 | Vadose Zone Soil | LHVNDNVRYWIATAPVGAASVLAEELAQFGAQDVRERSHDVKFQGTL |
| Ga0137413_102931041 | 3300012924 | Vadose Zone Soil | VSDNILYWIATAPVGAASVLTEELAQFGASDIRERSHDVKFQGTLEVGYRA |
| Ga0181534_108900591 | 3300014168 | Bog | MNGNVRYWIATAPVGAASVLAEELAQFGAQDIRERSH |
| Ga0182016_105859281 | 3300014493 | Bog | MNDNVLYWIATAPVGAASVLAEELVQFGATDIRERSHD |
| Ga0182019_114067471 | 3300014498 | Fen | MNDNVRYWIATAPVGAAAVLAEELAGFGASDIRERSHDVKFQGTLEVG |
| Ga0181522_107616211 | 3300014657 | Bog | LSGDQHNVRYWIATAPVGAASVLAEELADYGAGDIRERSHDVKFQGTLEV |
| Ga0181519_110688262 | 3300014658 | Bog | LSENVLYWIATAPVGAASVLAQELEVFGAAHIRERSHDVKFQGT |
| Ga0137412_105577473 | 3300015242 | Vadose Zone Soil | VNDNVRYWIATAPVGAASVLAEELAQFGASDIRERSHDVKFQ |
| Ga0187879_101195541 | 3300017946 | Peatland | VNESVRYWNATAPVGAASVLTEELREFGAVEIKERSHDVKFQGTLEV |
| Ga0179592_100392133 | 3300020199 | Vadose Zone Soil | VNDNVRYWIATAPVGAASVLAEELAQFGAQDIRERSHDVKFQGTLEVGYR |
| Ga0179592_102324162 | 3300020199 | Vadose Zone Soil | VNDNVRYWIATAPVGAASVLAEELAQFGAQDVRERS |
| Ga0210407_111823102 | 3300020579 | Soil | MTENVRYWIATAPVGAASVLAEELALLGGSDIRERSHDVK |
| Ga0210403_101975301 | 3300020580 | Soil | LSDPENVRYWIATAPVGAASVMAEELVQFGADDIR |
| Ga0210399_105445811 | 3300020581 | Soil | VNGNVRYWIATAPVGAASVLAEELAQFGANDIRERSHDVKFQGTLEVGYRA |
| Ga0210401_113511782 | 3300020583 | Soil | LHVNDNVRYWIATAPVGAASVLAEELTQFGAHDVRERSHDVK |
| Ga0210406_107085962 | 3300021168 | Soil | VSDNVRYWIATAPVGAASVLTEELAAFGASDIRERSHDVKF |
| Ga0210406_109337131 | 3300021168 | Soil | MNDNVRYWVATAPVGAASVLAEELAQFGAEDIRERS |
| Ga0210400_106742352 | 3300021170 | Soil | LHVNDNVRYWIATAPVGAASVLAEELTQFGAHDVRERSHDVKFQ |
| Ga0210396_108542041 | 3300021180 | Soil | LSAKDNVRYWIATAPVGAASVLAEELAQFGAEDIRERSHDVKFQGTLEVGYR |
| Ga0210388_100006271 | 3300021181 | Soil | LSVNDNVRYWVATAPVGAASVLAEELAQFGAEDIRERSHDVKFQGT |
| Ga0210388_107599292 | 3300021181 | Soil | LSVNDNVRYWVATAPVGAASVLAEELAQFGAEDIR |
| Ga0210389_107017941 | 3300021404 | Soil | MNDNVRYWVATAPVGAASVLAEELAQFGAEDIRERSHD |
| Ga0210387_101716403 | 3300021405 | Soil | LSVNDNVRYWVATAPVGAASVLAEELAQFGAEDIRERSHDVKFQGTLEV |
| Ga0210383_102747122 | 3300021407 | Soil | LSDPDNVRYWIATAPVGAASVLAEELLQFGAGDIRERS |
| Ga0210390_103979192 | 3300021474 | Soil | VNDNVRYWIATAPVGAAAVLAEELAQFGAHDIRERSHDVKFQGTLEVGY |
| Ga0210398_105143541 | 3300021477 | Soil | LSANDNVRYWIATAPVGAASVLAEELAQFGAEDIRERSHDVKFQG |
| Ga0210410_105261061 | 3300021479 | Soil | VNDNVRYWIATAPVGAASVLAEELTQFGAQDVRERSHDVK |
| Ga0224565_10477022 | 3300024176 | Plant Litter | VNENVRYWFATAPVGAASVLAEELAQFGAVEIRDRSHDVRF |
| Ga0247672_10904241 | 3300024187 | Soil | VNDNVRYWIATAPVGAASVLAEELAQFGAADIRERSHDVKFQGTLEVGYRT |
| Ga0247670_10666632 | 3300024283 | Soil | MNDNVRYWIATAPVGAASVLAEELAAFGASDIRERSHDVKFQGTLEV |
| Ga0179589_100376731 | 3300024288 | Vadose Zone Soil | VNDNVRYWIATAPVGAASVLAEELAQFGAQDVRERSH |
| Ga0209890_101396702 | 3300026291 | Soil | MNDNVRYWIATAPVGAAAVLAEELAQFGASDIRERSHDVKFQGTLEVGYRTC |
| Ga0209839_102403111 | 3300026294 | Soil | LSNRQDNVRYWIATAPVGAASVLAEELAQFGATDIRERSHDVKFQGT |
| Ga0209240_10939432 | 3300026304 | Grasslands Soil | VNDNVRYWIATAPVGAASVLAEELAQFGAQDVRERSHDVKFQGTLE |
| Ga0179587_100639261 | 3300026557 | Vadose Zone Soil | VNDNVRYWIATAPVGAASVLAEELAQFGAQDIRERSHDVKFQGTLEVGYRT |
| Ga0179587_109462271 | 3300026557 | Vadose Zone Soil | VSDNVRYWIATAPVGAASVLAEELAQFGAHDIRERSHDVKFQGTLEVGYRT |
| Ga0208987_10756622 | 3300027496 | Forest Soil | LSVNDNVRYWVATAPVGAASVLAEELAQFGAEDIRERSHDVKFQGTL |
| Ga0209736_10702252 | 3300027660 | Forest Soil | VNDNVRYWIATAPVGAASVLAEELAQFGAQDIRERSH |
| Ga0208990_11909571 | 3300027663 | Forest Soil | MAVPFNDNVRYWIATAPVGAASVLAEELAQFGADDVRERSHDVKFQGTL |
| Ga0208696_12109802 | 3300027696 | Peatlands Soil | LTLVTDNVRYWIATAPVGAASVLAEELVQYGAGDIRERSH |
| Ga0209038_102506061 | 3300027737 | Bog Forest Soil | LSDPDNVRYWIATAPVGAASVLAEELVQFGAADIRERSHDVR |
| Ga0209208_105080611 | 3300027807 | Host-Associated | VSDDIRYWVATAPVGAASVLAAELLEFGASDVRER |
| Ga0209040_105291892 | 3300027824 | Bog Forest Soil | LLDHGNVRYWIATAPIGAVSVLAQELAQYGAADIRERSHDVK |
| Ga0209611_102142142 | 3300027860 | Host-Associated | MRSNVRYWIATAPKGAAAVLAEELAQFGASDIRERSHDVKFQGTL |
| Ga0209611_105753852 | 3300027860 | Host-Associated | VATAPVGAASVLAEELAGLGATDIRERSSDVKFQGDL |
| Ga0209169_107560421 | 3300027879 | Soil | MSPERDDNVRYWIATAPVGAASVLAEELAQLGASDIR |
| Ga0209275_100409231 | 3300027884 | Soil | VNDNVRYWIATAPVGAASVLAEELAQFGAEDIRERSHDVKFQGTLEVGY |
| Ga0209698_111280671 | 3300027911 | Watersheds | MTDNVCYWIATAPVGAASVLAEELAQFGASDIRER |
| Ga0302151_102869432 | 3300028562 | Bog | VTDNVLYWIATAPVGAASVLAEELAAFGATDLRERSNDVKFQWTLE |
| Ga0302279_102424982 | 3300028783 | Bog | VNDSVRYWIATAPVGASSVLAEELAAFGAADIRERSHDVKFQGT |
| Ga0302228_100996611 | 3300028808 | Palsa | MPDNVRYWIATAPVGAASVLAEELAQFGAQDIKERSHDVKFQGTL |
| Ga0302157_102904571 | 3300028813 | Bog | MSGNVRYWIATAPVGAASVLAGELAQFGATDVRER |
| Ga0302157_104060382 | 3300028813 | Bog | MNGNVRYWIATAPVGAASVLAEELAQFGASDIRERSHDVK |
| Ga0311363_111003562 | 3300029922 | Fen | MGDNVLYWIATAPVGAASVLAEELAQFGAADIRERSHDVKFQGTLEVGYRA |
| Ga0311343_104427902 | 3300029953 | Bog | VSEDVRYWFATAPVGAASVLAEELAEFGAGNIRARSHDVKFQ |
| Ga0311339_104876302 | 3300029999 | Palsa | VSEDVRYWIATAPIGAASVLAEELKQFGASDIRGR |
| Ga0311339_111477712 | 3300029999 | Palsa | MNDNVLYWIATAPVGAASVLAQELAQFGAEDIRERSHDVKFQGNLEVG |
| Ga0302305_11733691 | 3300030046 | Palsa | VSEDVRYWIATAPIGAASVLAEELEQFGASDIRER |
| Ga0311353_114737962 | 3300030399 | Palsa | MNDNVLYWIATAPVGAASVLAQELAQFGAEDIRERSHD |
| Ga0302193_101875001 | 3300030519 | Bog | VSEDVRYWFATAPVGAASVLAEELAEFGAGNIRARSHDVKF |
| Ga0311372_115087491 | 3300030520 | Palsa | LSDPENVRYWIATAPVGAASVLAEELAQFGAVEIRERSHDVKFQ |
| Ga0265750_10501223 | 3300030813 | Soil | MNDNVRYWIATAPVGAASVLAEELAQFGAEDIRERSHDVKFQGA |
| Ga0170834_1095148281 | 3300031057 | Forest Soil | LNVNDNVRYWIATAPVGAASVLAEELAQFGAEDIRERSHDVKFQGTLEVGYR |
| Ga0170824_1113539772 | 3300031231 | Forest Soil | VNDNVRYWIATAPVGAASVLAEELAQFGAADIRERSHDVKF |
| Ga0302324_1018928852 | 3300031236 | Palsa | MCVSDNVLYWVATAPVGASSVLSEELAQFGAGDIRE |
| Ga0302324_1034388501 | 3300031236 | Palsa | VNDNVRYWIATAPVGAASVLAEELKQFGAEDIRERSHDVKFQG |
| Ga0302318_105404692 | 3300031258 | Bog | VSEDVRYWFATAPVGAASVLAEELAEFGAGNIRARSHDVKFQGT |
| Ga0302320_119843172 | 3300031524 | Bog | VNDSVRYWIATAPVGASSVLAEELAAFGAADIRER |
| Ga0310686_1074884421 | 3300031708 | Soil | LNDNVRYWIATAPVGAASVLAEELAQFGATDIRERSHDVKFQGTLEVG |
| Ga0307476_104361232 | 3300031715 | Hardwood Forest Soil | LSVNDNVRYWIATAPVGAASVLAEELAQFGAEDIRERSHDVKF |
| Ga0307474_115022482 | 3300031718 | Hardwood Forest Soil | VNDNVRYWIATAPVGAAAVLAEELAQFGAHDIRERSHDVKFQG |
| Ga0307477_110004742 | 3300031753 | Hardwood Forest Soil | VNDNVRYWIATAPVGAASVLAEELAQFGAHDVRER |
| Ga0307478_106269381 | 3300031823 | Hardwood Forest Soil | VSEDVRYWIATAPIGAASVLAEELEQFGASDIRERSHDVKFQGTLEV |
| Ga0302315_101767712 | 3300031837 | Palsa | MNDNVLYWIATAPVGAASVLAEELVQFGATDIRERSHDVKFQGTLE |
| Ga0307479_101762603 | 3300031962 | Hardwood Forest Soil | VNDNVRYWIATAPVGAAAVLAEELAQFGAEDIRERSHDVKFQGTLEVG |
| Ga0311301_118557672 | 3300032160 | Peatlands Soil | LTLVNDNVRYWIATAPVGAASVLAEELAQYGAGDIRERSHDVKFQGTLEVGYR |
| ⦗Top⦘ |