


| Basic Information | |
|---|---|
| Family ID | F106043 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MRTGIGIAIVVAIGLIWSVAVMSQWVPVASAEMRSAAVIEP |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 58.00 % |
| % of genes near scaffold ends (potentially truncated) | 48.00 % |
| % of genes from short scaffolds (< 2000 bps) | 93.00 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (60.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (35.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 49.28% β-sheet: 0.00% Coil/Unstructured: 50.72% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF03401 | TctC | 5.00 |
| PF13193 | AMP-binding_C | 5.00 |
| PF09992 | NAGPA | 3.00 |
| PF04392 | ABC_sub_bind | 2.00 |
| PF12773 | DZR | 2.00 |
| PF10038 | DUF2274 | 1.00 |
| PF13505 | OMP_b-brl | 1.00 |
| PF13701 | DDE_Tnp_1_4 | 1.00 |
| PF13432 | TPR_16 | 1.00 |
| PF03006 | HlyIII | 1.00 |
| PF10905 | DUF2695 | 1.00 |
| PF12706 | Lactamase_B_2 | 1.00 |
| PF05974 | DUF892 | 1.00 |
| PF02738 | MoCoBD_1 | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 5.00 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.00 |
| COG1272 | Predicted membrane channel-forming protein YqfA, hemolysin III family | Intracellular trafficking, secretion, and vesicular transport [U] | 1.00 |
| COG3685 | Ferritin-like metal-binding protein YciE | Inorganic ion transport and metabolism [P] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 60.00 % |
| All Organisms | root | All Organisms | 40.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352025|deepsgr__Contig_184662 | All Organisms → cellular organisms → Bacteria | 1467 | Open in IMG/M |
| 3300001661|JGI12053J15887_10021212 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3635 | Open in IMG/M |
| 3300004114|Ga0062593_100339650 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
| 3300004153|Ga0063455_101276808 | Not Available | 557 | Open in IMG/M |
| 3300004480|Ga0062592_101392870 | Not Available | 667 | Open in IMG/M |
| 3300005093|Ga0062594_102934147 | Not Available | 532 | Open in IMG/M |
| 3300005162|Ga0066814_10098839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 544 | Open in IMG/M |
| 3300005168|Ga0066809_10040885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1013 | Open in IMG/M |
| 3300005332|Ga0066388_100106227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3288 | Open in IMG/M |
| 3300005713|Ga0066905_100345702 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1186 | Open in IMG/M |
| 3300005713|Ga0066905_102001493 | Not Available | 537 | Open in IMG/M |
| 3300006028|Ga0070717_10950955 | Not Available | 782 | Open in IMG/M |
| 3300006048|Ga0075363_100777537 | Not Available | 581 | Open in IMG/M |
| 3300009100|Ga0075418_11182108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 829 | Open in IMG/M |
| 3300009156|Ga0111538_13267422 | Not Available | 564 | Open in IMG/M |
| 3300009156|Ga0111538_13598847 | Not Available | 537 | Open in IMG/M |
| 3300010043|Ga0126380_11166561 | Not Available | 661 | Open in IMG/M |
| 3300010047|Ga0126382_10158371 | Not Available | 1560 | Open in IMG/M |
| 3300010047|Ga0126382_10728772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 835 | Open in IMG/M |
| 3300010147|Ga0126319_1484015 | Not Available | 627 | Open in IMG/M |
| 3300010362|Ga0126377_10255633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1708 | Open in IMG/M |
| 3300010397|Ga0134124_10604642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1075 | Open in IMG/M |
| 3300010403|Ga0134123_10244223 | Not Available | 1558 | Open in IMG/M |
| 3300011000|Ga0138513_100029782 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300012212|Ga0150985_113191692 | Not Available | 685 | Open in IMG/M |
| 3300012356|Ga0137371_11042151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 618 | Open in IMG/M |
| 3300012469|Ga0150984_119820155 | Not Available | 741 | Open in IMG/M |
| 3300012491|Ga0157329_1033302 | Not Available | 546 | Open in IMG/M |
| 3300012683|Ga0137398_10579378 | Not Available | 775 | Open in IMG/M |
| 3300012938|Ga0162651_100044064 | Not Available | 689 | Open in IMG/M |
| 3300012971|Ga0126369_13647425 | Not Available | 504 | Open in IMG/M |
| 3300012984|Ga0164309_11590708 | Not Available | 560 | Open in IMG/M |
| 3300012986|Ga0164304_10669853 | Not Available | 784 | Open in IMG/M |
| 3300012989|Ga0164305_10929280 | Not Available | 733 | Open in IMG/M |
| 3300013105|Ga0157369_11980192 | Not Available | 591 | Open in IMG/M |
| 3300013297|Ga0157378_10205444 | Not Available | 1865 | Open in IMG/M |
| 3300014968|Ga0157379_10713709 | Not Available | 942 | Open in IMG/M |
| 3300014969|Ga0157376_11178770 | Not Available | 794 | Open in IMG/M |
| 3300015371|Ga0132258_10112946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6436 | Open in IMG/M |
| 3300015371|Ga0132258_12153588 | Not Available | 1401 | Open in IMG/M |
| 3300015372|Ga0132256_101665372 | Not Available | 747 | Open in IMG/M |
| 3300015374|Ga0132255_102298226 | Not Available | 823 | Open in IMG/M |
| 3300018027|Ga0184605_10068293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1536 | Open in IMG/M |
| 3300018028|Ga0184608_10228739 | Not Available | 817 | Open in IMG/M |
| 3300018028|Ga0184608_10249610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 781 | Open in IMG/M |
| 3300018054|Ga0184621_10285962 | Not Available | 583 | Open in IMG/M |
| 3300018067|Ga0184611_1132410 | Not Available | 878 | Open in IMG/M |
| 3300018072|Ga0184635_10365402 | Not Available | 552 | Open in IMG/M |
| 3300018469|Ga0190270_10129183 | All Organisms → cellular organisms → Bacteria | 2006 | Open in IMG/M |
| 3300018476|Ga0190274_13290850 | Not Available | 544 | Open in IMG/M |
| 3300018482|Ga0066669_10455268 | Not Available | 1099 | Open in IMG/M |
| 3300019767|Ga0190267_11078743 | Not Available | 574 | Open in IMG/M |
| 3300020000|Ga0193692_1110139 | Not Available | 571 | Open in IMG/M |
| 3300020016|Ga0193696_1031248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1425 | Open in IMG/M |
| 3300021082|Ga0210380_10032484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 2234 | Open in IMG/M |
| 3300022530|Ga0242658_1251077 | Not Available | 500 | Open in IMG/M |
| 3300022756|Ga0222622_10479741 | Not Available | 886 | Open in IMG/M |
| 3300022756|Ga0222622_11238131 | Not Available | 549 | Open in IMG/M |
| 3300025925|Ga0207650_10472354 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300025944|Ga0207661_11149599 | Not Available | 715 | Open in IMG/M |
| 3300025986|Ga0207658_11571019 | Not Available | 602 | Open in IMG/M |
| 3300026075|Ga0207708_11049556 | Not Available | 709 | Open in IMG/M |
| 3300027383|Ga0209213_1051573 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300027616|Ga0209106_1017958 | All Organisms → cellular organisms → Bacteria | 1526 | Open in IMG/M |
| 3300027903|Ga0209488_11117833 | Not Available | 537 | Open in IMG/M |
| 3300027909|Ga0209382_11002637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici | 870 | Open in IMG/M |
| 3300028707|Ga0307291_1029025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 1287 | Open in IMG/M |
| 3300028708|Ga0307295_10101867 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300028708|Ga0307295_10115173 | Not Available | 731 | Open in IMG/M |
| 3300028710|Ga0307322_10146512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 627 | Open in IMG/M |
| 3300028716|Ga0307311_10233762 | Not Available | 544 | Open in IMG/M |
| 3300028721|Ga0307315_10034965 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1356 | Open in IMG/M |
| 3300028755|Ga0307316_10044170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1486 | Open in IMG/M |
| 3300028787|Ga0307323_10125700 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300028793|Ga0307299_10004974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4602 | Open in IMG/M |
| 3300028803|Ga0307281_10126542 | Not Available | 880 | Open in IMG/M |
| 3300028810|Ga0307294_10121018 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300028811|Ga0307292_10488677 | Not Available | 527 | Open in IMG/M |
| 3300028819|Ga0307296_10252418 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300028824|Ga0307310_10008717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 3859 | Open in IMG/M |
| 3300028828|Ga0307312_10532165 | Not Available | 776 | Open in IMG/M |
| 3300028876|Ga0307286_10220956 | Not Available | 690 | Open in IMG/M |
| 3300028876|Ga0307286_10265873 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 630 | Open in IMG/M |
| 3300028878|Ga0307278_10369630 | Not Available | 631 | Open in IMG/M |
| 3300030988|Ga0308183_1080105 | Not Available | 712 | Open in IMG/M |
| 3300031093|Ga0308197_10227133 | Not Available | 650 | Open in IMG/M |
| 3300031096|Ga0308193_1067526 | Not Available | 566 | Open in IMG/M |
| 3300031099|Ga0308181_1046072 | Not Available | 812 | Open in IMG/M |
| 3300031114|Ga0308187_10313268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 593 | Open in IMG/M |
| 3300031170|Ga0307498_10194622 | Not Available | 703 | Open in IMG/M |
| 3300031199|Ga0307495_10243154 | Not Available | 514 | Open in IMG/M |
| 3300031421|Ga0308194_10347811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 527 | Open in IMG/M |
| 3300031505|Ga0308150_1018642 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300031740|Ga0307468_101618542 | Not Available | 606 | Open in IMG/M |
| 3300031854|Ga0310904_10815297 | Not Available | 654 | Open in IMG/M |
| 3300032000|Ga0310903_10677104 | Not Available | 555 | Open in IMG/M |
| 3300032205|Ga0307472_101879884 | Not Available | 597 | Open in IMG/M |
| 3300033551|Ga0247830_10943509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 688 | Open in IMG/M |
| 3300034417|Ga0364941_189785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 530 | Open in IMG/M |
| 3300034817|Ga0373948_0026334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Erythrobacter/Porphyrobacter group → Erythrobacter → unclassified Erythrobacter → Erythrobacter sp. HL-111 | 1145 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 35.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 6.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.00% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 2.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.00% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.00% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.00% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.00% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.00% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.00% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 1.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.00% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012938 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300020000 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1 | Environmental | Open in IMG/M |
| 3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300030988 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031096 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031505 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_139 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034417 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17 | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deepsgr_03167720 | 2199352025 | Soil | MLIKAQRTGIVGIAVVVAIGLLWSVAVMSKWVPLASAEMRSAAVIQP |
| JGI12053J15887_100212125 | 3300001661 | Forest Soil | MRTGMGIALLVAIGLIWSVAVMSEWVPVASAELRLAAVIKP* |
| Ga0062593_1003396503 | 3300004114 | Soil | MRTGIGIAIVVAIGLIWSVAVMSQWVPVASAEMRSAAVIEP* |
| Ga0063455_1012768082 | 3300004153 | Soil | MLIKAQRTGIVGIAVVVAIGLLWSVAVMSNWVPVTSAEMRSAAVIQPYEAGRHKAAAQ* |
| Ga0062592_1013928702 | 3300004480 | Soil | MRTGIGIAIMVAIGLIWSVAVMSQWVPVASAEMRSAAVIEP* |
| Ga0062594_1029341472 | 3300005093 | Soil | MRTGIGIAVLVAIGLIWSVAVMSQWVPVASPEMKSAALIQPHEA |
| Ga0066814_100988391 | 3300005162 | Soil | MRTGIGIAVVVAIGLIWSVAVMSQWVPVASPEMKSAALIQPHEANRH* |
| Ga0066809_100408852 | 3300005168 | Soil | MRTGIGIAVLVAIGLIWSVAVMSQWVPVASPEMKSAALIQPHEANRH* |
| Ga0066388_1001062273 | 3300005332 | Tropical Forest Soil | MLIKAQRTGIVGIAVVVALGLIWSVAVMSKWVPVASAEMRSAAVIQP* |
| Ga0066905_1003457022 | 3300005713 | Tropical Forest Soil | MEAIMLTKAQRTGIVGIAVVVAIGLLWSVAVMFKWVPVANAEMRSAAVIQP* |
| Ga0066905_1020014932 | 3300005713 | Tropical Forest Soil | KAQRTGIVGIAVVVAIGLLWSVAVMFKWVPVASAEMRSAAVIQP* |
| Ga0070717_109509552 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRAHRGLQMRIGIGIAVVVAIGLIWSIAVMSQWVPMASAEMRSAALIQPFEAGRR* |
| Ga0075363_1007775371 | 3300006048 | Populus Endosphere | MMEGEQMRIEISIAVVVAIGLIWSVAVMSEWIPMASAELMSAAVVKP* |
| Ga0075418_111821082 | 3300009100 | Populus Rhizosphere | MRTGIGIAIMVAIGLIWSVAVMSQWVPVASAEMRLAAVMEP* |
| Ga0111538_132674221 | 3300009156 | Populus Rhizosphere | MRAGIVGITVVAIGLIWSVAVMSKLVPVDGSELRSTEI |
| Ga0111538_135988471 | 3300009156 | Populus Rhizosphere | MEAIMLIKAQRTGIVGIAVVVAIGLIWSVAVMSKWVPVASAEMESAAVIQPYEAGRHKAAAQ* |
| Ga0126380_111665611 | 3300010043 | Tropical Forest Soil | MEAIMLIKAQRTGIVGIAVVVALGLIWAVAVMSKWVPVASAEMRSAAVIQP* |
| Ga0126382_101583711 | 3300010047 | Tropical Forest Soil | MEAIMLIKAQRTGIVGIAVVVAIGLLWSVAVMFKWVPVASAEMRSAAVIQP* |
| Ga0126382_107287721 | 3300010047 | Tropical Forest Soil | GIVGIAVVVALGLIWSVAVMSKWVPVASAEMRSAAVIQP* |
| Ga0126319_14840151 | 3300010147 | Soil | AIMLIKAQRTGIVGIAVVVAIGLLWSVAVMSKWVPLASAEMRSAAVIQP* |
| Ga0126377_102556335 | 3300010362 | Tropical Forest Soil | MEAIMLIKAQRTGIIGIAVVVALGLIWSVAVMSKWVPVASAEMRSAAVIQP* |
| Ga0134124_106046422 | 3300010397 | Terrestrial Soil | MEAIMLIKAQRTGIVGIAVVVAIGLLWSVAVMSKLVPVDGSEISLAAISRPAE* |
| Ga0134123_102442231 | 3300010403 | Terrestrial Soil | MRIGIGIAVVVAIGLIWSVAVMSQWVPVTSAEMSLAAVIQPYEAGRHKAAAQ* |
| Ga0138513_1000297822 | 3300011000 | Soil | MEAIMLIKAQRTGIVGIAVVVAIGLLWSVAVMSKWVPLAGAEMRSAAVIQP* |
| Ga0150985_1131916921 | 3300012212 | Avena Fatua Rhizosphere | MRTGIGIAVVVAIGLIWSVAVMSQWVPVASPEMKSSALIQPHEANRH* |
| Ga0137371_110421512 | 3300012356 | Vadose Zone Soil | MRTGTWMGLAVVVAIGLIWSLAAMLELVPVNSAEMRSAAESPH |
| Ga0150984_1198201551 | 3300012469 | Avena Fatua Rhizosphere | MLINVQRAGIIGIVVVFAIGLLWSIAVMSNWVPVASAEMSSAAVLQPYEHGRQRAAAQ* |
| Ga0157329_10333022 | 3300012491 | Arabidopsis Rhizosphere | MEAIMLIKAQRTGIVGIAVVVAIGLLWSVAVMSKLVPVDGSEMSSPAISRPAE* |
| Ga0137398_105793781 | 3300012683 | Vadose Zone Soil | MEAIMLIKAQRTGIVGIAVVVAIGLLWSVAVMSKWVPLASAEMRSAAVIQP* |
| Ga0162651_1000440642 | 3300012938 | Soil | FRDTGIIWSVAVMSQWVPVASPEMRSAALIPPYETRRH* |
| Ga0126369_136474252 | 3300012971 | Tropical Forest Soil | MRAGIVGIAVVVAMGLIWSVAVMSKLVPLDGSEMRSA |
| Ga0164309_115907081 | 3300012984 | Soil | MEATMLIKVQHAGIVGIAVVVAIGLLWSVAVMSKWVPVASAEMISATVIPPYEAGRHEAAAQ* |
| Ga0164304_106698531 | 3300012986 | Soil | MEAIMLIKAQRTGIVGIAVVVALGLLWSVAVMSKLVPVDGSEISLAAISRPAE* |
| Ga0164305_109292803 | 3300012989 | Soil | MLIKAQRTGIVGIAVVVAIGLIWSVAAMSKLVPVDGSEMSSAAISRPAE* |
| Ga0157369_119801922 | 3300013105 | Corn Rhizosphere | RSIAMRTGIGIAIVVAIGLIWSVAVMSQWVPVASPEMKSAALIQPHEANRH* |
| Ga0157378_102054441 | 3300013297 | Miscanthus Rhizosphere | MRTGIGIAVVVAIGLIWSVAVMSQWVPVASPEMKSAALIQPPRG* |
| Ga0157379_107137091 | 3300014968 | Switchgrass Rhizosphere | MRIGIGIAVVVAIGLIWSVAVMSQWVPVTSAEMSFSAVMQPYEAGRHKAAAQ* |
| Ga0157376_111787701 | 3300014969 | Miscanthus Rhizosphere | TGIGIAVVVAIGLIWSVAVMSQWVPVASPEMKSAALIQPHEANRH* |
| Ga0132258_101129467 | 3300015371 | Arabidopsis Rhizosphere | MEAIMLIRAQRTGIVGIAVVVAIGLIWSVAAMSKLVPVDGSEMSSAAISRPAE* |
| Ga0132258_121535882 | 3300015371 | Arabidopsis Rhizosphere | MRIGISIAVVVAIGLIWSVAVMSEWIPMASAELMSAAVVKP* |
| Ga0132256_1016653721 | 3300015372 | Arabidopsis Rhizosphere | MRTGISIAIVVAIGLIWSVAVMSQWVPVASPEMKSAALIQPHEANRH* |
| Ga0132255_1022982261 | 3300015374 | Arabidopsis Rhizosphere | MRTGISIAIVVAIGLIWSVAVMSQWVPVASAEMRSAAVIQP* |
| Ga0184605_100682932 | 3300018027 | Groundwater Sediment | MRKGIGIAVVVAMGLIWSVAVMSQWVPVASAEMRSAAAIKTP |
| Ga0184608_102287391 | 3300018028 | Groundwater Sediment | KVQRAGIVGIAVVVAIGLLWSVAVMSKWVPLAGAEMRSAAVIQP |
| Ga0184608_102496102 | 3300018028 | Groundwater Sediment | MRKGIGIAVVVAMGLIWSVAVMSQWVPVASAEMRSAAAIQTP |
| Ga0184621_102859622 | 3300018054 | Groundwater Sediment | MQMRKGIGIAVVVAMGLIWSVAVMSQWVPVASAEMRSAAAIQTP |
| Ga0184611_11324101 | 3300018067 | Groundwater Sediment | MRTGIGIAVVVAIGLIWSVAVMSQWVPVASPEMKSAALIQPHEANRH |
| Ga0184635_103654021 | 3300018072 | Groundwater Sediment | RTGIVGIAVVVAIGLLWSVAVMSKWVPLAGAEMRSAAVIQP |
| Ga0190270_101291831 | 3300018469 | Soil | MRTGIGLAVVVAIGLIWSVAVMSQWVPVASPEMKSAALIQPREANRR |
| Ga0190274_132908501 | 3300018476 | Soil | MRTGIGIAVVVAIGLIWSVAVMSQWVPVASPEMKSAALIQPPRG |
| Ga0066669_104552682 | 3300018482 | Grasslands Soil | MRTCIGIAVVVAIGLIWSVAVMFEWIPVNRSEMSAA |
| Ga0190267_110787431 | 3300019767 | Soil | MRIGIGMTVVVAIGLIWSIAVMSQWVPLTSVEMQSAALIQPYEAGRP |
| Ga0193692_11101392 | 3300020000 | Soil | MEAIMLIKAQRTGIVGIAVVVAIGLLWSVAVMSKWVPLASAEMRSAAVIQP |
| Ga0193696_10312483 | 3300020016 | Soil | MRTGIGIAVLVAIGLIWSVAVMSQWVPVASPEMKSAALIQPHEANRH |
| Ga0210380_100324841 | 3300021082 | Groundwater Sediment | MLIKAQRTGIVGIAVVVAIGLLWSVAVMSKWVPLAGAEMRSAAVIQP |
| Ga0242658_12510771 | 3300022530 | Soil | RTAIVGIAVVVAIGLLWSVAVMSKWVPLAGAEMRSAAVIQP |
| Ga0222622_104797411 | 3300022756 | Groundwater Sediment | MRTGIGIAVVVAIGLIWSVAVMSQWVPVASPEMKSAALIQH |
| Ga0222622_112381312 | 3300022756 | Groundwater Sediment | MQMRKGIGIAVVVAMGLIWSVAVMSQWVPVASAEMRSAAAIKTP |
| Ga0207650_104723542 | 3300025925 | Switchgrass Rhizosphere | MRTGIGIAIMVAIGLIWSVAVMSQWVPVASAEMRSAAVIEP |
| Ga0207661_111495992 | 3300025944 | Corn Rhizosphere | MRTGIGIAIVVAIGLIWSVAVMSQWVPVASAEMRSAAVIEP |
| Ga0207658_115710192 | 3300025986 | Switchgrass Rhizosphere | MRTGIGIAIVVAIGLIWSVAVMSQWVPVASPEMKSAALIQPHEANRH |
| Ga0207708_110495562 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | IGIAVLVAIGLIWSVAVMSQWVPVASPEMKSAALIQPHEANRH |
| Ga0209213_10515732 | 3300027383 | Forest Soil | MRTGMGIALLVAIGLIWSVAVMSEWVPVASAELRLAAVIKP |
| Ga0209106_10179583 | 3300027616 | Forest Soil | MQMRTGMGIALLVAIGLIWSVAVMSEWVPVASAELRLAAVIKP |
| Ga0209488_111178331 | 3300027903 | Vadose Zone Soil | MRTGIGIATVVAIGLIWSVAVMSQWVPVASAEMRLAAVIEP |
| Ga0209382_110026373 | 3300027909 | Populus Rhizosphere | MRAGIVGIAVVVAIGLIWSVAVMSKLVPVDGSEMRSAA |
| Ga0307291_10290253 | 3300028707 | Soil | AVVVAIGLIWSVAVMSQWVPVASAEMRSAAAIQTP |
| Ga0307295_101018672 | 3300028708 | Soil | MLIKAQRTGIVGIAVVVAIGLLWSVAVMSKWVPLASAE |
| Ga0307295_101151732 | 3300028708 | Soil | IAVVVAIGLLWSVAVMSKWVPLAGAEMRSAAVIQP |
| Ga0307322_101465121 | 3300028710 | Soil | MRTGIGIAVVVAIGLIWSVAVMSQWVPVASPEMKSAALI |
| Ga0307311_102337622 | 3300028716 | Soil | MEAIMLIKAQRTGIVGIAVVVAIGLLWSVAVMSKWVPLAGAEMRSAAVIQP |
| Ga0307315_100349653 | 3300028721 | Soil | PWMEAIMLIKAQRTGIVGIAVVVAIGLLWSVAVMSKWVPLAGAEMRSAAVIQP |
| Ga0307316_100441704 | 3300028755 | Soil | GIAVVVAMGLIWSVAVMSQWVPVASAEMRSAAAIKTP |
| Ga0307323_101257002 | 3300028787 | Soil | MLIKAQRTGIVGIAVVVAIGLLWSVAVMSKWVPLAGAEMRSAAV |
| Ga0307299_100049748 | 3300028793 | Soil | GIAVVVAMGLIWSVAVMSQWVPVASAEMRSAAAIQTP |
| Ga0307281_101265421 | 3300028803 | Soil | SPWMEAIMLIKAQRTGIVGIAVVVAIGLLWSVAVMSKWVPLAGAEMRSAAVIQP |
| Ga0307294_101210182 | 3300028810 | Soil | MLIKAQRTGIVGIAVVVAIGLLWSVAVMSKWVPLAGAE |
| Ga0307292_104886771 | 3300028811 | Soil | MLIKAQRTGIVGIAVVVAIGLLWSVAVMSKWVPLASAEMRS |
| Ga0307296_102524182 | 3300028819 | Soil | MEAIMLIKAQRTGIVGIAVVVAIGLLWSVAVMSKWVPLASAEMRPAAVIQP |
| Ga0307310_100087171 | 3300028824 | Soil | IGIAVVVAMGLIWSVAVMSQWVPVASAEMRSAAAIQTP |
| Ga0307312_105321651 | 3300028828 | Soil | GIAVVVAIGLLWSVAVMSKWVPLAGAEMRSAAVIQP |
| Ga0307286_102209561 | 3300028876 | Soil | QRQAEGMQMRTGMGIALLVAIGLIWSVAVMSEWVPVASAELRLAAVIKP |
| Ga0307286_102658732 | 3300028876 | Soil | ERELQMRTGIGIAVVVAIGLIWSVAVMSQWVPVASPEMKSAALIQPHEANRH |
| Ga0307278_103696302 | 3300028878 | Soil | IAMRTGIGIATVVAIGLIWSVAVMSQWIPVASAEMRLAAVIESR |
| Ga0308183_10801052 | 3300030988 | Soil | ASPWMEAIMLIKAQRTGIVGIAVVVAIGLLWSVAVMSKWVPLAGAEMRSAAVIQP |
| Ga0308197_102271332 | 3300031093 | Soil | AIMLIKAQRTGIVGIAVVVAIGLLWSVAVMSKWVPLAGAEMRSAAVIQP |
| Ga0308193_10675261 | 3300031096 | Soil | GIAVVVAIGLLWSVAVMSKWVPLASAEMRSAAVIQP |
| Ga0308181_10460723 | 3300031099 | Soil | EAIMLIKAQRTGIVGIAVVVAIGLLWSVAVMSKWVPLASAEMRSAAVIQP |
| Ga0308187_103132681 | 3300031114 | Soil | TRDAEGMQMRKGIGIAVVVAMGLIWSVAVMSQWVPVASAEMRSAAAIKTP |
| Ga0307498_101946221 | 3300031170 | Soil | MLIKAQRTAIVGIAVVVAIGLLWSVAVMSKWVPLAGAEMRSAAVIQP |
| Ga0307495_102431542 | 3300031199 | Soil | PWMEAIMLIKAQRTGIVGIAVVVAIGLLWSVAVMSKWVPLASAEMRSAAVIQP |
| Ga0308194_103478111 | 3300031421 | Soil | RGRGIAMRTGIGIATVVAIGLIWSVAVMSQWIPVASAEMRLAAVIEP |
| Ga0308150_10186421 | 3300031505 | Soil | AEGLQMRIGIGIAVVVAIGLIWSVAVMSQWVPVASPEMKSAALIQPPRG |
| Ga0307468_1016185422 | 3300031740 | Hardwood Forest Soil | MEAIMLIKAQRTGIVGIAVVVAIGLIWSVAVMSKWVPVASAETRSAAVIQP |
| Ga0310904_108152971 | 3300031854 | Soil | MRTGIGIAVVVAIGLIWSVAVMSQWVPVASPEMKSATLIQ |
| Ga0310903_106771041 | 3300032000 | Soil | IAVLVAIGLIWSVAVMSQWVPVASPEMKSAALIQPHEANRH |
| Ga0307472_1018798841 | 3300032205 | Hardwood Forest Soil | MLIKAQRTGIVGIAVVVAIGLLWSVAVMSKWVPVTSAEMSSAAVIQPYEAGRHKAA |
| Ga0247830_109435091 | 3300033551 | Soil | MRTGIGIAVLVAIGLIWSVAVMSQWVPVASPEMKSAALIQP |
| Ga0364941_189785_421_528 | 3300034417 | Sediment | MRTGIGIAVLVAIGLIWSVAVMSQWVPVASPEMKSA |
| Ga0373948_0026334_1_120 | 3300034817 | Rhizosphere Soil | IGISIAVVVAIGLIWSVAVMSEWIPMASAELMSAAVVKP |
| ⦗Top⦘ |