


| Basic Information | |
|---|---|
| Family ID | F105942 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 45 residues |
| Representative Sequence | ADVTLTKHVSLRAIQVEYLYTHFGGASQNNLRLQSGIVWRFGR |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 89.00 % |
| Associated GOLD sequencing projects | 78 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.75% β-sheet: 0.00% Coil/Unstructured: 42.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF07238 | PilZ | 5.00 |
| PF01712 | dNK | 4.00 |
| PF01887 | SAM_HAT_N | 3.00 |
| PF07638 | Sigma70_ECF | 3.00 |
| PF12867 | DinB_2 | 3.00 |
| PF08818 | DUF1801 | 2.00 |
| PF00106 | adh_short | 1.00 |
| PF13564 | DoxX_2 | 1.00 |
| PF14110 | DUF4282 | 1.00 |
| PF08281 | Sigma70_r4_2 | 1.00 |
| PF12680 | SnoaL_2 | 1.00 |
| PF13545 | HTH_Crp_2 | 1.00 |
| PF00027 | cNMP_binding | 1.00 |
| PF03601 | Cons_hypoth698 | 1.00 |
| PF01040 | UbiA | 1.00 |
| PF01740 | STAS | 1.00 |
| PF04389 | Peptidase_M28 | 1.00 |
| PF04140 | ICMT | 1.00 |
| PF00248 | Aldo_ket_red | 1.00 |
| PF00580 | UvrD-helicase | 1.00 |
| PF00004 | AAA | 1.00 |
| PF04909 | Amidohydro_2 | 1.00 |
| PF12969 | DUF3857 | 1.00 |
| PF02357 | NusG | 1.00 |
| PF00069 | Pkinase | 1.00 |
| PF06452 | CBM9_1 | 1.00 |
| PF08241 | Methyltransf_11 | 1.00 |
| PF13505 | OMP_b-brl | 1.00 |
| PF07690 | MFS_1 | 1.00 |
| PF07366 | SnoaL | 1.00 |
| PF11999 | Ice_binding | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 4.00 |
| COG1428 | Deoxyadenosine/deoxycytidine kinase | Nucleotide transport and metabolism [F] | 4.00 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 3.00 |
| COG1912 | Stereoselective (R,S)-S-adenosylmethionine hydrolase (adenosine-forming) | Defense mechanisms [V] | 3.00 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 2.00 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 2.00 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 2.00 |
| COG0210 | Superfamily I DNA or RNA helicase | Replication, recombination and repair [L] | 1.00 |
| COG0250 | Transcription termination/antitermination protein NusG | Transcription [K] | 1.00 |
| COG1074 | 3’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V) | Replication, recombination and repair [L] | 1.00 |
| COG2855 | Uncharacterized membrane protein YadS, UPF0324 family | Function unknown [S] | 1.00 |
| COG3973 | DNA helicase IV | Replication, recombination and repair [L] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.00 % |
| Unclassified | root | N/A | 20.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_100912551 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300001593|JGI12635J15846_10648026 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300004479|Ga0062595_101692481 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300005174|Ga0066680_10077810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1997 | Open in IMG/M |
| 3300005332|Ga0066388_102504857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus | 938 | Open in IMG/M |
| 3300005439|Ga0070711_100239939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1417 | Open in IMG/M |
| 3300005445|Ga0070708_100590052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1047 | Open in IMG/M |
| 3300005467|Ga0070706_100890201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 822 | Open in IMG/M |
| 3300005539|Ga0068853_100283248 | All Organisms → cellular organisms → Bacteria | 1528 | Open in IMG/M |
| 3300005842|Ga0068858_102342081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 528 | Open in IMG/M |
| 3300006047|Ga0075024_100497730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus | 638 | Open in IMG/M |
| 3300006059|Ga0075017_101516914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus | 528 | Open in IMG/M |
| 3300006163|Ga0070715_11015073 | Not Available | 518 | Open in IMG/M |
| 3300006794|Ga0066658_10587523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 606 | Open in IMG/M |
| 3300006796|Ga0066665_11236238 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300006903|Ga0075426_10433287 | Not Available | 972 | Open in IMG/M |
| 3300006954|Ga0079219_10904470 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 714 | Open in IMG/M |
| 3300006954|Ga0079219_11530182 | Not Available | 606 | Open in IMG/M |
| 3300007255|Ga0099791_10037307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2149 | Open in IMG/M |
| 3300007265|Ga0099794_10533672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300009089|Ga0099828_10277918 | All Organisms → cellular organisms → Bacteria | 1504 | Open in IMG/M |
| 3300009090|Ga0099827_11489048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300010048|Ga0126373_10268879 | All Organisms → cellular organisms → Bacteria | 1686 | Open in IMG/M |
| 3300010320|Ga0134109_10485492 | Not Available | 508 | Open in IMG/M |
| 3300010358|Ga0126370_10042363 | All Organisms → cellular organisms → Bacteria | 2838 | Open in IMG/M |
| 3300010358|Ga0126370_10390447 | Not Available | 1140 | Open in IMG/M |
| 3300010359|Ga0126376_12395333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300010361|Ga0126378_11667816 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300010362|Ga0126377_11717925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
| 3300010364|Ga0134066_10204788 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300010376|Ga0126381_100478512 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1752 | Open in IMG/M |
| 3300010376|Ga0126381_101126342 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
| 3300010376|Ga0126381_103735736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 595 | Open in IMG/M |
| 3300011269|Ga0137392_11568282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300011269|Ga0137392_11637972 | Not Available | 501 | Open in IMG/M |
| 3300012189|Ga0137388_11163459 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300012205|Ga0137362_11797892 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300012362|Ga0137361_10062748 | All Organisms → cellular organisms → Bacteria | 3115 | Open in IMG/M |
| 3300012362|Ga0137361_10856805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 825 | Open in IMG/M |
| 3300012363|Ga0137390_11027505 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
| 3300012925|Ga0137419_10158372 | All Organisms → cellular organisms → Bacteria | 1642 | Open in IMG/M |
| 3300012929|Ga0137404_10094525 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2398 | Open in IMG/M |
| 3300012929|Ga0137404_12013275 | Not Available | 539 | Open in IMG/M |
| 3300012948|Ga0126375_11255301 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300015241|Ga0137418_10491866 | Not Available | 983 | Open in IMG/M |
| 3300015242|Ga0137412_10089391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2505 | Open in IMG/M |
| 3300016319|Ga0182033_10752670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto → Firmicutes bacterium HGW-Firmicutes-11 | 856 | Open in IMG/M |
| 3300016371|Ga0182034_10260311 | All Organisms → cellular organisms → Bacteria | 1373 | Open in IMG/M |
| 3300016387|Ga0182040_10350680 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 3300018482|Ga0066669_10513242 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300020140|Ga0179590_1080459 | Not Available | 866 | Open in IMG/M |
| 3300020579|Ga0210407_10312562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1227 | Open in IMG/M |
| 3300020579|Ga0210407_10597994 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 860 | Open in IMG/M |
| 3300020580|Ga0210403_10093487 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2434 | Open in IMG/M |
| 3300020580|Ga0210403_10243743 | Not Available | 1474 | Open in IMG/M |
| 3300020580|Ga0210403_10472416 | Not Available | 1020 | Open in IMG/M |
| 3300020580|Ga0210403_11250799 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300020581|Ga0210399_10005522 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9826 | Open in IMG/M |
| 3300020581|Ga0210399_10076720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2710 | Open in IMG/M |
| 3300020581|Ga0210399_10500120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1010 | Open in IMG/M |
| 3300020582|Ga0210395_10565899 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300020583|Ga0210401_10902932 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300021170|Ga0210400_10985076 | Not Available | 686 | Open in IMG/M |
| 3300021171|Ga0210405_10332058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1200 | Open in IMG/M |
| 3300021403|Ga0210397_10765791 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 744 | Open in IMG/M |
| 3300021432|Ga0210384_10035800 | All Organisms → cellular organisms → Bacteria | 4597 | Open in IMG/M |
| 3300021432|Ga0210384_11037061 | Not Available | 722 | Open in IMG/M |
| 3300021560|Ga0126371_11275958 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300022533|Ga0242662_10224705 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300024178|Ga0247694_1034974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella pectinivorans | 565 | Open in IMG/M |
| 3300024232|Ga0247664_1031983 | Not Available | 1226 | Open in IMG/M |
| 3300024246|Ga0247680_1030741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 777 | Open in IMG/M |
| 3300024323|Ga0247666_1029390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1150 | Open in IMG/M |
| 3300025906|Ga0207699_10768521 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter acidisoli | 707 | Open in IMG/M |
| 3300025922|Ga0207646_11295144 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300025981|Ga0207640_11379343 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300026315|Ga0209686_1083453 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1127 | Open in IMG/M |
| 3300026319|Ga0209647_1296822 | Not Available | 543 | Open in IMG/M |
| 3300026723|Ga0208342_101544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 676 | Open in IMG/M |
| 3300026909|Ga0207858_1008793 | Not Available | 1011 | Open in IMG/M |
| 3300027010|Ga0207839_1034946 | Not Available | 570 | Open in IMG/M |
| 3300027330|Ga0207777_1048616 | Not Available | 754 | Open in IMG/M |
| 3300027610|Ga0209528_1121348 | Not Available | 576 | Open in IMG/M |
| 3300027875|Ga0209283_10307811 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300027882|Ga0209590_10509681 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300027915|Ga0209069_10586433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 640 | Open in IMG/M |
| 3300027915|Ga0209069_10748866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus | 578 | Open in IMG/M |
| 3300031231|Ga0170824_103053322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1468 | Open in IMG/M |
| 3300031474|Ga0170818_104491854 | Not Available | 655 | Open in IMG/M |
| 3300031545|Ga0318541_10534161 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 656 | Open in IMG/M |
| 3300031720|Ga0307469_10045616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus | 2707 | Open in IMG/M |
| 3300031744|Ga0306918_10026133 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3621 | Open in IMG/M |
| 3300031942|Ga0310916_10237814 | All Organisms → cellular organisms → Bacteria | 1532 | Open in IMG/M |
| 3300031942|Ga0310916_10923652 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300031947|Ga0310909_10847704 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300031954|Ga0306926_10896233 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1062 | Open in IMG/M |
| 3300031962|Ga0307479_10478238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1229 | Open in IMG/M |
| 3300032076|Ga0306924_10337614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1728 | Open in IMG/M |
| 3300032174|Ga0307470_11201962 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300034125|Ga0370484_0065791 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 916 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.00% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024178 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK35 | Environmental | Open in IMG/M |
| 3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
| 3300024246 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21 | Environmental | Open in IMG/M |
| 3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026723 | Grasslands soil microbial communities from Chapel Hill, North Carolina, USA that are Nitrogen fertilized - NN357 (SPAdes) | Environmental | Open in IMG/M |
| 3300026909 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 23 (SPAdes) | Environmental | Open in IMG/M |
| 3300027010 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 64 (SPAdes) | Environmental | Open in IMG/M |
| 3300027330 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1009125511 | 3300000955 | Soil | LTRHVSLRAIQVEYLYTHFGGASQNNLRLQSGIVYRFGR* |
| JGI12635J15846_106480261 | 3300001593 | Forest Soil | AFAAAAGGGADVTLTRHVSFRAIQVDYLYTHFAGAGQNNLRIQSGLVWRFGR* |
| Ga0062595_1016924811 | 3300004479 | Soil | TLTKHVSFRAIQVEYLYTHFGGASQNNLRIQSGLVWRFGR* |
| Ga0066680_100778101 | 3300005174 | Soil | VTLTRHVSFRAIQVEYLYTHFGGASQNNLRLQSGIVWRIGR* |
| Ga0066388_1025048571 | 3300005332 | Tropical Forest Soil | DITLTRHVSFRAIQVEYLYTHFGGASQNSVRLQSGIVWRFGR* |
| Ga0070711_1002399391 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | ITLTRHVSFRAIQVEYLYTHFGGANQNNLRIQSGLVWRFGR* |
| Ga0070708_1005900521 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LTRHVSFRAIQVEYLYTHFGGASQNNLRLQSGIVWRIGR* |
| Ga0070706_1008902011 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | TLTRHVSFRAIQVEYLYTHFGGASQNNLRLQSGIVWRIGR* |
| Ga0068853_1002832481 | 3300005539 | Corn Rhizosphere | AGGGADVTLTKHVSFRAIQVEYLYTHFGGASQNNLRIQSGLVWRFGR* |
| Ga0068858_1023420812 | 3300005842 | Switchgrass Rhizosphere | TLSKHVSLRAAQFDYFYTHFGGEGQNNFRIQTGIVYRFGR* |
| Ga0075024_1004977302 | 3300006047 | Watersheds | TNAFAMTFGGGADVTLTRHVSFRAIQVEYLYTHFGGASQNNMRIETGLVWRFGR* |
| Ga0075017_1015169142 | 3300006059 | Watersheds | SVNSFAMTFGGGADVRLTPRLSFRAIQAEYLYTHFSGVKQNNLRIQSGLVYHFGK* |
| Ga0070715_110150731 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | GAGSGSSNAFATALGGGADVTLTRHVSLRALQVDYFYTHFGGASQNNFRLQSGIVWRIGR |
| Ga0066658_105875232 | 3300006794 | Soil | GGGADFQVTHHLAFRAIQLEYLYTHFSGAKQNNLRLQSGLVYRFGK* |
| Ga0066665_112362382 | 3300006796 | Soil | SFRAIQVEYLYTHFGGASQNNLRLQSGIVWRIGR* |
| Ga0075426_104332871 | 3300006903 | Populus Rhizosphere | ADITLSKHVSLRAAQFDYLYTHFGGEGQNNFRIQSGIVYRFGR* |
| Ga0079219_109044702 | 3300006954 | Agricultural Soil | GGADVTLTRHVSLRLIQVEYLYTHFSSASQNSLKLQSGIVWRFGR* |
| Ga0079219_115301822 | 3300006954 | Agricultural Soil | GGADFTLTHHLAFRAIQFEYLYTHFGGAKQNNLRIQSGLVYRFGK* |
| Ga0099791_100373072 | 3300007255 | Vadose Zone Soil | AMTFGGGADVQLTPRLSFRAIQFEYLYTHFGGAKQNNLRIQSGLVYHFGK* |
| Ga0099794_105336721 | 3300007265 | Vadose Zone Soil | RHLAFRAIQFEYLYTHFSGAKQNNLRIQSGLVYRFGR* |
| Ga0099828_102779183 | 3300009089 | Vadose Zone Soil | LAFRAIQVEYLYTHFGGTRQNNMRLQSGLVYRFGR* |
| Ga0099827_114890482 | 3300009090 | Vadose Zone Soil | SVNSFAMTFGGGADVKLTPHLAFRAIQFEYLYTHFSGVKQNNLRIQSGLVYHFGK* |
| Ga0126373_102688794 | 3300010048 | Tropical Forest Soil | TKHVSLRAIQVEYLYTHFGGASQNNLRLQSGIVWRFGR* |
| Ga0134109_104854921 | 3300010320 | Grasslands Soil | DVTLSRHVSFRAIQVEYLYTHFGGASQNNLRLQSGIVWRIGR* |
| Ga0126370_100423631 | 3300010358 | Tropical Forest Soil | TLSKHVSLRAAQFDYFYTHFGGEGQNNFRIQSGIVYRFGR* |
| Ga0126370_103904473 | 3300010358 | Tropical Forest Soil | SLRAIQVEYFYTHFSSASQNNLRLQSGVVWRFGR* |
| Ga0126376_123953331 | 3300010359 | Tropical Forest Soil | AWTAGGGVDATLTQHVTFRAIQFEYLYTHLDGASQNSFRLQSGIVYRFGR* |
| Ga0126378_116678162 | 3300010361 | Tropical Forest Soil | TFRAIQFEYMYTHFGGASQNSFRLQSGIVYRFGR* |
| Ga0126377_117179252 | 3300010362 | Tropical Forest Soil | GGGADITLTRHVSLRALQVEYLYTHFGGASQNNLRLQSGLVWRFGR* |
| Ga0134066_102047881 | 3300010364 | Grasslands Soil | TLTRHVSFRAIQVEYLYTHFSSANQNSLRLQSGIVWRFGR* |
| Ga0126381_1004785122 | 3300010376 | Tropical Forest Soil | LTKHVSLRAIQVEYLYTHFGGASQNNLRLQSGIVWRFGR* |
| Ga0126381_1011263421 | 3300010376 | Tropical Forest Soil | HVSLRAAQFDYFYTHFGGEGQNNFRIQSGIVYRFGR* |
| Ga0126381_1037357361 | 3300010376 | Tropical Forest Soil | DVTLTKHVSLRAIQVEYLYTHFGGASQNNLRLQSGIVWRFDR* |
| Ga0137392_115682822 | 3300011269 | Vadose Zone Soil | SRHLAFRAIQFEYLYTHFSGAKQNNLRIQSGLVYRFGR* |
| Ga0137392_116379721 | 3300011269 | Vadose Zone Soil | TNAFAMTFGGGADVQLTPHLSFRAIQFEYLYTHFSGAKQNNLRIQSGLVYHFGK* |
| Ga0137388_111634591 | 3300012189 | Vadose Zone Soil | FGGGADVKLTPHLAFRAIQFEYLYTHFSGAKQNNLRIQSGLVYHFGK* |
| Ga0137362_117978921 | 3300012205 | Vadose Zone Soil | LGGGADVTLTRHVSLRALQVDYLYTHFGGASQNNFRLQSGIVWRIGR* |
| Ga0137361_100627484 | 3300012362 | Vadose Zone Soil | PSTSVNSFAMTFGGGADVKLTPHLAFRAIQFEYLYTHFSGAKQNNLRIQSGLVYHFGK* |
| Ga0137361_108568051 | 3300012362 | Vadose Zone Soil | PSTSVNSFAMTFGGGADVKLTPHLAFRAIQFEYLYTHFSGVKQNNLRIQSGLVYHFGK* |
| Ga0137390_110275052 | 3300012363 | Vadose Zone Soil | DFQVSRHLAFRAIQFEYLYTHFSGAKQNNLRIQSGLVYRFGR* |
| Ga0137419_101583723 | 3300012925 | Vadose Zone Soil | GSGSSNAFASAIGGGADVTLTRHLSLRAFQLDYLYTHFNSSSQNNFRLQSGLVYRFGR* |
| Ga0137404_100945251 | 3300012929 | Vadose Zone Soil | RHVSFRAIQVEYLYTHFGGASQNNLRLQSGIVWRIGR* |
| Ga0137404_120132752 | 3300012929 | Vadose Zone Soil | LSRHVTLRALQVDYLYTHFGGASQNNFRLQSGIVWRIGR* |
| Ga0126375_112553011 | 3300012948 | Tropical Forest Soil | KHVSLRAAQFDYFYTHFGGEGQNHFRIQSGIVYRFGR* |
| Ga0137418_104918663 | 3300015241 | Vadose Zone Soil | IGGGADVTLTRHLSLRAFQLDYLYTHFNSSSQNNFRLQSGLVYRFGR* |
| Ga0137412_100893911 | 3300015242 | Vadose Zone Soil | STNAFATAVGGGADVTLTRHVSLRALQVDYLYTHFGGASQNNFRLQSGIVWRIGR* |
| Ga0182033_107526703 | 3300016319 | Soil | VSLRAIQVEYLYTHFGGASQNNLRLQSGIVWRFGR |
| Ga0182034_102603114 | 3300016371 | Soil | GGGADVTLTKHVSLRAIQVEYLYTHFGGASQNNLRLQSGIVWRFGR |
| Ga0182040_103506803 | 3300016387 | Soil | TLTKHVSLRAIQVEYLYTHFGGASQNNLRLQSGIVWRFGR |
| Ga0066669_105132422 | 3300018482 | Grasslands Soil | AGGGADVTLTRHLSLRAIQVDYLYTHFGGASQNNFRLQSGIVYRFGR |
| Ga0179590_10804591 | 3300020140 | Vadose Zone Soil | ALATAVGGGADVTLTRHVSLRALQVDYLYTHFGGASQNNFRLQSGIVWRIGR |
| Ga0210407_103125622 | 3300020579 | Soil | TAVGGGADVTLTRHVSLRALQVDYLYTHFGGASQNNFRLQSGIVWRIGR |
| Ga0210407_105979942 | 3300020579 | Soil | ADVTLTRHVSFRAIQVDYLYTHFAGTGQNNLRIQSGLVWRFGR |
| Ga0210403_100934875 | 3300020580 | Soil | ADVTLSRHVTLRALQVDYLYTHFSGASQNNFRLQSGIVWRIGR |
| Ga0210403_102437431 | 3300020580 | Soil | RHVSLRALQVDYLYTHFGGASQNNFRLQSGIVWRIGR |
| Ga0210403_104724161 | 3300020580 | Soil | DVTLTRHLSLRALQVDYLYTHFGGASQNNFRLQSGIVWRIGR |
| Ga0210403_112507992 | 3300020580 | Soil | GFPSASVNSFAMTFGGGADIQLTPRLSFRAIQGEYLYTHFSGAKQNNLRIQSGLVYHFGK |
| Ga0210399_1000552212 | 3300020581 | Soil | LSRHVTLRALQVDYLYTHFSGASQNNFRLQSGIVWRIGR |
| Ga0210399_100767201 | 3300020581 | Soil | STNAFATALGGGADVTLTRHVSLRALQVDYLYTHFGGASQNNFRLQSGIVWRIGR |
| Ga0210399_105001202 | 3300020581 | Soil | TAVGGGADVTLSRHVTLRALQVDYLYTHFSGASQNNFRLQSGIVWRIGR |
| Ga0210395_105658992 | 3300020582 | Soil | GVDVTLTRHVSFRAIQVEYLYTHFGGASQNNVRIQSGLVWRFGR |
| Ga0210401_109029322 | 3300020583 | Soil | SANSFAMTFGGGADIQLTHHLAFRAIQAEYFYTRFGGVGQNNLRIQSGLVYRFSK |
| Ga0210400_109850761 | 3300021170 | Soil | VPSTSVNSFAMTFGGGADIKLTPHVSFRAIQFEYLYTHFSGVKQNNLRIQSGLVYHFGK |
| Ga0210405_103320583 | 3300021171 | Soil | NAFAAAVGGGADVTLTRHVSLRALQVDYLYTHFGGASQNNFRLQSGIVWRIGR |
| Ga0210397_107657911 | 3300021403 | Soil | VTLSRHVTLRALQVDYLYTHFSGASQNNFRLQSGIVWRIGR |
| Ga0210384_100358006 | 3300021432 | Soil | NAYAMTFGGGADFTVTPHLAFRAIQFEYLYTHFGGAKQNNLRIQSGLVYRFGK |
| Ga0210384_110370612 | 3300021432 | Soil | GSTNAFATALGGGADVTLTRHVSLRALQVDYLYTHFGGASQNNFRLQSGIVWRIGR |
| Ga0126371_112759582 | 3300021560 | Tropical Forest Soil | GGADVTLSKHVSLRAIQFDYLYTRFGGASQNNLRLQSGIVWRFGR |
| Ga0242662_102247051 | 3300022533 | Soil | TNAFATALGGGADVTLTRHVSLRALQVDYLYTHFGGASQNNFRLQSGIVWRIGR |
| Ga0247694_10349741 | 3300024178 | Soil | MTFGGGADFQVSRHFAFRAIQVEYLYTHFSGAKQNNVRIQSGLVYRFGK |
| Ga0247664_10319833 | 3300024232 | Soil | DITLSKHVSLRAAQFDYLYTHFGGEGQNSFRIQSGIVYRFSR |
| Ga0247680_10307411 | 3300024246 | Soil | AAAVGGGADVTLTRHVSLRAVQVDYLYTHFGGASQNNFRVQSGIVWRIGR |
| Ga0247666_10293901 | 3300024323 | Soil | GGGADVTLTRHVSLRALQVDYLYTHFGGASQNNFRLQSGIVWRIGR |
| Ga0207699_107685212 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | STDVVTLTRHVSLRAIQVDYLYTHFGGAGQNNLRIQSGLVWRFGR |
| Ga0207646_112951441 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | RHVSFRAIQVEYLYTHFGGASQNNLRLQSGIVWRIGR |
| Ga0207640_113793431 | 3300025981 | Corn Rhizosphere | AGGGADVTLTKHVSFRAIQVEYLYTHFGGASQNNLRIQSGLVWRFGR |
| Ga0209686_10834531 | 3300026315 | Soil | GSLASNAFAWTAGGGADVTLTRHVSLRAIQVEYLYTRFGGASQNSMRVQSGIVWRFGR |
| Ga0209647_12968221 | 3300026319 | Grasslands Soil | TLTRHLSLRAFQLDYLYTHFNSASQNNFRLQSGLVYRFGR |
| Ga0208342_1015442 | 3300026723 | Soil | WGADITLTRHVSFRAQADYLYTHFSSANQNSLRLQSGIVWRFGR |
| Ga0207858_10087932 | 3300026909 | Tropical Forest Soil | GGGADVTLTQHVSLRAIQVEYLYTHFGGASQNSFRLQSGIVWRFGR |
| Ga0207839_10349462 | 3300027010 | Tropical Forest Soil | LTQHVSLRAIQVEYLYTHFGGASQNSFRLQSGIVWRFGR |
| Ga0207777_10486161 | 3300027330 | Tropical Forest Soil | TLTQHVSLRAIQVEYLYTHFGGASQNSFRLQSGIVWRFGR |
| Ga0209528_11213481 | 3300027610 | Forest Soil | GGADFKVTRHLAFRAIQLEYLYTHFGGAKQNNLRLQSGLVYRFGK |
| Ga0209283_103078111 | 3300027875 | Vadose Zone Soil | LAFRAIQVEYLYTHFGGARQNNMRLQSGLVYRFGR |
| Ga0209590_105096811 | 3300027882 | Vadose Zone Soil | GADFQVTRHLAFRAIQVEYLYTHFGGARQNNMRLQSGLVYRFGR |
| Ga0209069_105864332 | 3300027915 | Watersheds | TNAFAMTFGGGADVTLTRHVSFRAIQVEYLYTHFGGASQNNMRIETGLVWRFGR |
| Ga0209069_107488662 | 3300027915 | Watersheds | ATGFPSASVNSFAMTFGGGADVRLTPRLSFRAIQAEYLYTHFSGAKQNNLRIQSGLVYHFGK |
| Ga0170824_1030533221 | 3300031231 | Forest Soil | SNAFATALGGGADVTLTRHVSLRAIQVDYLYTHFSGAGQNNLRIQSGLVWRFGR |
| Ga0170818_1044918541 | 3300031474 | Forest Soil | AAAGGGADVTLTKHLSLRAIQVDYLYTHFSGASQNNFRLQSGIVYRFGR |
| Ga0318541_105341612 | 3300031545 | Soil | SKHVSLRAIQFDYLYTHFGGASQNNLRLQSGIVWRFGR |
| Ga0307469_100456161 | 3300031720 | Hardwood Forest Soil | ASVNSFAMTFGGGADVRLTPRLSFRAIQAEYLYTHFSGVKQNNLRIQSGLVYHFGK |
| Ga0306918_100261338 | 3300031744 | Soil | ISLRAIQVEYLYTHFGGASQNNLRLQSGIVWRFGR |
| Ga0310916_102378143 | 3300031942 | Soil | ADVTLTKHVSLRAIQVEYLYTHFGGASQNNLRLQSGIVWRFGR |
| Ga0310916_109236523 | 3300031942 | Soil | HISLRAAQFDYFYTHFGGEGQNNFRIQSGIVYRFGR |
| Ga0310909_108477042 | 3300031947 | Soil | ADVTLSKHVSLRAIQVEYLYTHFGGASQNNLRIQSGIVWRFGR |
| Ga0306926_108962331 | 3300031954 | Soil | HVSLRAIQVEYLYTHFGGASQNNLRLQSGIVWRFGR |
| Ga0307479_104782382 | 3300031962 | Hardwood Forest Soil | AFAMTFGGGADVELTRHLSFRAIQFEYLYTHFSGAKQNNLRIQSGLVYHFGK |
| Ga0306924_103376141 | 3300032076 | Soil | TKHVSLRAIQVEYLYTHFGNASQNNLRLQSGIVWRFGR |
| Ga0307470_112019621 | 3300032174 | Hardwood Forest Soil | DITLSKHVSLRAVQFDYFYTHFGGEGQNNFRIQSGIVYRFGR |
| Ga0370484_0065791_3_161 | 3300034125 | Untreated Peat Soil | AFAAAAGGGADVTLTRHVSLRAIQVDYLYTHFAGAGQNNLRIQSGLVWRFGR |
| ⦗Top⦘ |