


| Basic Information | |
|---|---|
| Family ID | F105937 |
| Family Type | Metagenome |
| Number of Sequences | 100 |
| Average Sequence Length | 45 residues |
| Representative Sequence | AVGDYLERYVYGPPTWSDYLDLFGGERLALQAKRAKELTR |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.00 % |
| % of genes from short scaffolds (< 2000 bps) | 95.00 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (20.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.59% β-sheet: 0.00% Coil/Unstructured: 54.41% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF01144 | CoA_trans | 75.00 |
| PF00296 | Bac_luciferase | 19.00 |
| PF00857 | Isochorismatase | 1.00 |
| PF00293 | NUDIX | 1.00 |
| PF12399 | BCA_ABC_TP_C | 1.00 |
| PF00528 | BPD_transp_1 | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG1788 | Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit | Lipid transport and metabolism [I] | 75.00 |
| COG2057 | Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunit | Lipid transport and metabolism [I] | 75.00 |
| COG4670 | Acyl CoA:acetate/3-ketoacid CoA transferase | Lipid transport and metabolism [I] | 75.00 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 19.00 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 1.00 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 50.00 % |
| Unclassified | root | N/A | 50.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_109401739 | Not Available | 610 | Open in IMG/M |
| 3300004157|Ga0062590_102394352 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300004463|Ga0063356_105455881 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300005167|Ga0066672_10384733 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300005171|Ga0066677_10618879 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300005179|Ga0066684_10791697 | Not Available | 627 | Open in IMG/M |
| 3300005187|Ga0066675_10208978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1375 | Open in IMG/M |
| 3300005454|Ga0066687_10918844 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300005467|Ga0070706_101594738 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300005540|Ga0066697_10075277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1942 | Open in IMG/M |
| 3300005552|Ga0066701_10666675 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300005553|Ga0066695_10103686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1745 | Open in IMG/M |
| 3300005564|Ga0070664_101652997 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300005586|Ga0066691_10771281 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300005713|Ga0066905_100167431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae | 1605 | Open in IMG/M |
| 3300006034|Ga0066656_10372342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 923 | Open in IMG/M |
| 3300006163|Ga0070715_11103331 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300006794|Ga0066658_10133107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Ancylobacter → unclassified Ancylobacter → Ancylobacter sp. | 1233 | Open in IMG/M |
| 3300006797|Ga0066659_10024384 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3521 | Open in IMG/M |
| 3300006806|Ga0079220_12073696 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300006844|Ga0075428_100012275 | All Organisms → cellular organisms → Bacteria | 9527 | Open in IMG/M |
| 3300006844|Ga0075428_102453384 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300006852|Ga0075433_10359403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1286 | Open in IMG/M |
| 3300006954|Ga0079219_11594840 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300007004|Ga0079218_10477666 | Not Available | 1093 | Open in IMG/M |
| 3300009012|Ga0066710_103975771 | Not Available | 553 | Open in IMG/M |
| 3300009038|Ga0099829_10146479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1881 | Open in IMG/M |
| 3300009038|Ga0099829_10840944 | Not Available | 762 | Open in IMG/M |
| 3300009088|Ga0099830_10220364 | All Organisms → cellular organisms → Bacteria | 1491 | Open in IMG/M |
| 3300009100|Ga0075418_11597343 | Not Available | 708 | Open in IMG/M |
| 3300009137|Ga0066709_102237093 | Not Available | 752 | Open in IMG/M |
| 3300009147|Ga0114129_10824512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1181 | Open in IMG/M |
| 3300009162|Ga0075423_11047554 | Not Available | 868 | Open in IMG/M |
| 3300009678|Ga0105252_10535225 | Not Available | 541 | Open in IMG/M |
| 3300009792|Ga0126374_11047930 | Not Available | 643 | Open in IMG/M |
| 3300009795|Ga0105059_1065902 | Not Available | 512 | Open in IMG/M |
| 3300009801|Ga0105056_1071333 | Not Available | 517 | Open in IMG/M |
| 3300009817|Ga0105062_1108133 | Not Available | 555 | Open in IMG/M |
| 3300010043|Ga0126380_10625263 | Not Available | 852 | Open in IMG/M |
| 3300010301|Ga0134070_10060660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Ancylobacter → unclassified Ancylobacter → Ancylobacter sp. | 1282 | Open in IMG/M |
| 3300010325|Ga0134064_10020112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1882 | Open in IMG/M |
| 3300010325|Ga0134064_10067698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1123 | Open in IMG/M |
| 3300010329|Ga0134111_10477929 | Not Available | 544 | Open in IMG/M |
| 3300010335|Ga0134063_10698373 | Not Available | 524 | Open in IMG/M |
| 3300010358|Ga0126370_12624924 | Not Available | 504 | Open in IMG/M |
| 3300010359|Ga0126376_10524618 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1102 | Open in IMG/M |
| 3300010361|Ga0126378_10211455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2020 | Open in IMG/M |
| 3300010366|Ga0126379_12590313 | Not Available | 605 | Open in IMG/M |
| 3300010398|Ga0126383_10393122 | All Organisms → cellular organisms → Bacteria | 1421 | Open in IMG/M |
| 3300011269|Ga0137392_10792363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 783 | Open in IMG/M |
| 3300011270|Ga0137391_11556508 | Not Available | 505 | Open in IMG/M |
| 3300012208|Ga0137376_10822132 | Not Available | 799 | Open in IMG/M |
| 3300012349|Ga0137387_10812613 | Not Available | 676 | Open in IMG/M |
| 3300012351|Ga0137386_10819155 | Not Available | 669 | Open in IMG/M |
| 3300012362|Ga0137361_10355148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Ancylobacter → unclassified Ancylobacter → Ancylobacter sp. | 1345 | Open in IMG/M |
| 3300012685|Ga0137397_10205106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Ancylobacter → unclassified Ancylobacter → Ancylobacter sp. | 1467 | Open in IMG/M |
| 3300012929|Ga0137404_11071772 | Not Available | 739 | Open in IMG/M |
| 3300012944|Ga0137410_11945521 | Not Available | 522 | Open in IMG/M |
| 3300012972|Ga0134077_10066977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Ancylobacter → unclassified Ancylobacter → Ancylobacter sp. FA202 | 1349 | Open in IMG/M |
| 3300012975|Ga0134110_10202362 | Not Available | 833 | Open in IMG/M |
| 3300012986|Ga0164304_10483932 | Not Available | 900 | Open in IMG/M |
| 3300014150|Ga0134081_10248914 | Not Available | 621 | Open in IMG/M |
| 3300014154|Ga0134075_10134079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1056 | Open in IMG/M |
| 3300014877|Ga0180074_1077230 | Not Available | 732 | Open in IMG/M |
| 3300015241|Ga0137418_10413990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1097 | Open in IMG/M |
| 3300015245|Ga0137409_11203553 | Not Available | 598 | Open in IMG/M |
| 3300015359|Ga0134085_10472351 | Not Available | 571 | Open in IMG/M |
| 3300015359|Ga0134085_10535210 | Not Available | 539 | Open in IMG/M |
| 3300018053|Ga0184626_10108661 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
| 3300018058|Ga0187766_10650627 | Not Available | 724 | Open in IMG/M |
| 3300018074|Ga0184640_10152832 | Not Available | 1030 | Open in IMG/M |
| 3300019789|Ga0137408_1333573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Ancylobacter → unclassified Ancylobacter → Ancylobacter sp. FA202 | 1216 | Open in IMG/M |
| 3300020170|Ga0179594_10031100 | All Organisms → cellular organisms → Bacteria | 1705 | Open in IMG/M |
| 3300025322|Ga0209641_10334700 | Not Available | 1106 | Open in IMG/M |
| 3300026296|Ga0209235_1048687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2054 | Open in IMG/M |
| 3300026298|Ga0209236_1167483 | Not Available | 898 | Open in IMG/M |
| 3300026315|Ga0209686_1134557 | Not Available | 791 | Open in IMG/M |
| 3300026317|Ga0209154_1288144 | Not Available | 544 | Open in IMG/M |
| 3300026324|Ga0209470_1093898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Ancylobacter → unclassified Ancylobacter → Ancylobacter sp. FA202 | 1355 | Open in IMG/M |
| 3300026328|Ga0209802_1211470 | Not Available | 731 | Open in IMG/M |
| 3300026332|Ga0209803_1088868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Ancylobacter → unclassified Ancylobacter → Ancylobacter sp. FA202 | 1280 | Open in IMG/M |
| 3300026333|Ga0209158_1087312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1207 | Open in IMG/M |
| 3300026334|Ga0209377_1050694 | All Organisms → cellular organisms → Bacteria | 1857 | Open in IMG/M |
| 3300026342|Ga0209057_1005341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8898 | Open in IMG/M |
| 3300027637|Ga0209818_1042311 | Not Available | 1078 | Open in IMG/M |
| 3300027643|Ga0209076_1097387 | Not Available | 835 | Open in IMG/M |
| 3300027748|Ga0209689_1337666 | Not Available | 577 | Open in IMG/M |
| 3300027875|Ga0209283_10092665 | All Organisms → cellular organisms → Bacteria | 1970 | Open in IMG/M |
| (restricted) 3300028043|Ga0233417_10620484 | Not Available | 516 | Open in IMG/M |
| 3300028792|Ga0307504_10284711 | Not Available | 617 | Open in IMG/M |
| 3300030006|Ga0299907_10446034 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300031561|Ga0318528_10329092 | Not Available | 820 | Open in IMG/M |
| 3300031716|Ga0310813_10151264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1867 | Open in IMG/M |
| 3300031720|Ga0307469_11199297 | Not Available | 717 | Open in IMG/M |
| 3300031740|Ga0307468_102131713 | Not Available | 540 | Open in IMG/M |
| 3300031744|Ga0306918_11480004 | Not Available | 519 | Open in IMG/M |
| 3300031764|Ga0318535_10124531 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
| 3300032017|Ga0310899_10739181 | Not Available | 502 | Open in IMG/M |
| 3300033475|Ga0310811_10353267 | Not Available | 1647 | Open in IMG/M |
| 3300034164|Ga0364940_0149313 | Not Available | 673 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 20.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 11.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.00% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 3.00% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.00% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.00% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.00% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009795 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50 | Environmental | Open in IMG/M |
| 3300009801 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 | Environmental | Open in IMG/M |
| 3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014877 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300027637 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028043 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MG | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300034164 | Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1094017392 | 3300000955 | Soil | AAVGEYLERYVYGPPAWSDYLDLFGGERLALQAKRAKELTR* |
| Ga0062590_1023943522 | 3300004157 | Soil | AIDTGGPLAVVDYLERYVHAPATYDDYLELFGGERLAQQRARARELTT* |
| Ga0063356_1054558812 | 3300004463 | Arabidopsis Thaliana Rhizosphere | GGPLAVVDYLERYVHAPATYDDYLELFGGERLAQQRARARELTT* |
| Ga0066672_103847332 | 3300005167 | Soil | VGDYLERYVYGPPTWSDYLELFGGERMGLQAKRARELTR* |
| Ga0066677_106188792 | 3300005171 | Soil | TDYLERYAYAPPTWGDYLDLFGGERLALQHRRARELVGP* |
| Ga0066684_107916972 | 3300005179 | Soil | ARGPEAAVADYLARYVYAPSAWDDYLDLFGGERLAKQQKQARELTQ* |
| Ga0066675_102089781 | 3300005187 | Soil | YTRAIDARGPAAVADYLERYAYAPPTWGDYLDLFGGERLALQQRRARELTGP* |
| Ga0066687_109188442 | 3300005454 | Soil | FEHFGAYTASIDARGPETAVGEYLARHVYAPPTWDDYLELFGGERLARQRAAARELTG* |
| Ga0070706_1015947382 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | GPAAVGDYLERYVYGPPTWSDYLDLFGGERMGLQAKRARELTR* |
| Ga0066697_100752771 | 3300005540 | Soil | ADYLERYVYAPPTWGDYLDLFGGERLALQQRRARELVGA* |
| Ga0066701_106666751 | 3300005552 | Soil | VGDYLERYVYGPPTWSDYLDLFGGERMGLQAKRARELTR* |
| Ga0066695_101036861 | 3300005553 | Soil | YLERYAYAPPTWGDYLDLFGGERLALQQRRARELTGE* |
| Ga0070664_1016529971 | 3300005564 | Corn Rhizosphere | AEYCAAIDRSGPAAVRDYLERYVYGPPTWNDYLDLFGGERMAVLAKQARELTR* |
| Ga0066691_107712812 | 3300005586 | Soil | AVGDYLERYVYGPPTWSDYLDLFGGERMGLQAKRARELTR* |
| Ga0066905_1001674311 | 3300005713 | Tropical Forest Soil | ARGPETAVGDYLTRYVYGPPTWDDYLELFGGERLAQQQKCARELTQ* |
| Ga0066656_103723421 | 3300006034 | Soil | RGPAAVADYLERYAYAPPTWSDYLDLFGGERLALQGRRARELTGL* |
| Ga0070715_111033311 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | DHFAEYCAAIDRSGPAAVRDYLERYVYGPPTWNDYLDLFGGERMAVLAKQARELTR* |
| Ga0066658_101331071 | 3300006794 | Soil | RYVYAPPTWGDYLDLFGGERLALQQRRARELVGGLE* |
| Ga0066659_100243845 | 3300006797 | Soil | LARYVYGPPTWDDYLELFGGERLARQRAAARELTA* |
| Ga0079220_120736961 | 3300006806 | Agricultural Soil | IDRSGPAAVRDYLERYVYGPPTWTDYLDLFGGERMAVLAKQARELTR* |
| Ga0075428_1000122751 | 3300006844 | Populus Rhizosphere | ARYVYGPPSWDDYLDLFGGERLAQQRALARELTQ* |
| Ga0075428_1024533841 | 3300006844 | Populus Rhizosphere | FAEYCAAIDARGPAAVGDYLERYVYTPPTWGDYLDLFGGERMALQAKRAKELTR* |
| Ga0075433_103594031 | 3300006852 | Populus Rhizosphere | ADYDHFAEYCAAIDRSGPAAVREYLERYVYGPPTWNDYLDLFGGERMAVLAKQARELTR* |
| Ga0079219_115948401 | 3300006954 | Agricultural Soil | EADFDHFGTYTAAIDTRGPETAVGDYLTRYVYGPPTWDDYLELFGGERLAQQQKRARELTQ* |
| Ga0079218_104776662 | 3300007004 | Agricultural Soil | QAVTDYIARYVDAPATYADYLDLFGGERLARQQRAARELVPR* |
| Ga0066710_1039757712 | 3300009012 | Grasslands Soil | AVGDYLERYVYGPPTWSDYLDLFGGERMGLQAKRARELTR |
| Ga0099829_101464791 | 3300009038 | Vadose Zone Soil | AAIDARGPAAVGEYLERYVYGPPAWNDYLDLFGGERLALQAKRARELTR* |
| Ga0099829_108409441 | 3300009038 | Vadose Zone Soil | YLERYAYAPPTFADYLDLFGGERLARQVRRARELTVDA* |
| Ga0099830_102203643 | 3300009088 | Vadose Zone Soil | EYLERYVYGPPAWNDYLDLFGGERLALQAKRARELTR* |
| Ga0075418_115973431 | 3300009100 | Populus Rhizosphere | EADFEHFGAYTASIDARGPEAAVGDYLARYVYGPPSWDEYLDLFGGERLAKQRALAKELTG* |
| Ga0066709_1022370931 | 3300009137 | Grasslands Soil | ARGPEAAVGEYLARYVYGPPTWDDYLELFGGERLARQRAAARELTA* |
| Ga0114129_108245121 | 3300009147 | Populus Rhizosphere | LERYVYGPPTWTDYLDLFGGERMARQVKQAKELTR* |
| Ga0075423_110475542 | 3300009162 | Populus Rhizosphere | IDARGPAAVGDYLERYVYGAPTWSDYLDLFGGERMALQVKRAKELTR* |
| Ga0105252_105352252 | 3300009678 | Soil | SAVVDYLDRHVFGPATFADYLDLFGGARLAAQQRKARELTR* |
| Ga0126374_110479302 | 3300009792 | Tropical Forest Soil | VDRNGPAAVGDYLERYVYAPPTWGDYLGLFGGERMAVQAKRAKELTR* |
| Ga0105059_10659021 | 3300009795 | Groundwater Sand | GPAAVGEYLERYVYGPPAWNDYLDLFGGERLALQAKRARELTR* |
| Ga0105056_10713332 | 3300009801 | Groundwater Sand | AVSDYLERYVYGPASWHDYLDLFGGERLALQVKRAKELTR* |
| Ga0105062_11081332 | 3300009817 | Groundwater Sand | GRGPTAVVDYLERYVFRPPTFTDYLDLFGGARLAAQQRKARELTR* |
| Ga0126380_106252632 | 3300010043 | Tropical Forest Soil | DRNGPAAVGDYLERYVYAPPTWGDYLGLFGGARMAVQAKRAKELTR* |
| Ga0134070_100606603 | 3300010301 | Grasslands Soil | ERYAYAPPTWSDYLDLFGGERLALQGRRARELTGL* |
| Ga0134064_100201121 | 3300010325 | Grasslands Soil | AVADYLERYVYAPPTWGDYLDLFGGERLALQQRRARELVGA* |
| Ga0134064_100676981 | 3300010325 | Grasslands Soil | LARYVYAPSAWDDYLDLFGGERLAKQQKQARELTQ* |
| Ga0134111_104779292 | 3300010329 | Grasslands Soil | PGAVGDYLERYVYGPPAWTDYLDLFGSERLALQAKRAKELTR* |
| Ga0134063_106983731 | 3300010335 | Grasslands Soil | PEAAVGEYLARHVYGPPTWDDYLELFGGERLARQRAAAKELTG* |
| Ga0126370_126249241 | 3300010358 | Tropical Forest Soil | DYLERYVYAPASFSDYLELFGGERLAAQQRAARELTG* |
| Ga0126376_105246182 | 3300010359 | Tropical Forest Soil | ADYDHFAEYTAAIDARGPAAVREYLERYVYGPPAWSDYLDLFGGERLALQVKRSKELTRGTP* |
| Ga0126378_102114551 | 3300010361 | Tropical Forest Soil | ERYVYAPPTWGDYVGLFGGARMAVQAKRAKELTR* |
| Ga0126379_125903132 | 3300010366 | Tropical Forest Soil | EYLERYVYGPPAWSDYLDLFGGARLALQAKRAKELTR* |
| Ga0126383_103931221 | 3300010398 | Tropical Forest Soil | SAVGEYLERYVYGPPAWSDYLDLFGGARLALQAKRARELTR* |
| Ga0137392_107923632 | 3300011269 | Vadose Zone Soil | VADYLERYAYAPPTWSDYLDLFGGERLALQGRRARELTGL* |
| Ga0137391_115565081 | 3300011270 | Vadose Zone Soil | AVADYLERYAYAPPTWSDYLDLFGGERLALQGRRARELMCL* |
| Ga0137376_108221321 | 3300012208 | Vadose Zone Soil | LARHVYGPPTWDDYLELFGGERLARQRAAAKELTG* |
| Ga0137387_108126132 | 3300012349 | Vadose Zone Soil | VGEYLGRYVYGPPTWDDYLELFGGERLARQRAAARELTA* |
| Ga0137386_108191551 | 3300012351 | Vadose Zone Soil | DYLELDVCVPRASSDYLDLFGGERLALQAKRAKELTR* |
| Ga0137361_103551481 | 3300012362 | Vadose Zone Soil | PAAVADYLERYAYAPPTWSDYLDLFGGERLALQRRRARELTGG* |
| Ga0137397_102051061 | 3300012685 | Vadose Zone Soil | IDARGPETAVGEYLARYVYGPPTWGDYLELFGGERLAKQRAAARELTA* |
| Ga0137404_110717722 | 3300012929 | Vadose Zone Soil | AAIDARGPGAVGEYLERYVYRPPAWTDYLDLFGGERLALQAKRARELTR* |
| Ga0137410_119455211 | 3300012944 | Vadose Zone Soil | VGEYLARYVYGPPTWGDYLELFGGERLAKQRAAARELTA* |
| Ga0134077_100669773 | 3300012972 | Grasslands Soil | AAVADYLERYAYAPPTWSDYLDLFGGERLALQGRRARELTGL* |
| Ga0134110_102023622 | 3300012975 | Grasslands Soil | RAIDARGPAAVADYLERYAYAPPTWSDYLDLFGGERLALQGRRARELTGL* |
| Ga0164304_104839322 | 3300012986 | Soil | RSGPAAVGDYLERYVYGPPTWSDYLDLFGGERMALQVKRAKELTR* |
| Ga0134081_102489141 | 3300014150 | Grasslands Soil | IDARGPTAVADYLERYVYAPPTWGDYLDLFGGERLALQQRRARELTGE* |
| Ga0134075_101340791 | 3300014154 | Grasslands Soil | LARYVYGPPSWDDYLELFGGERLARQRAAARELTA* |
| Ga0180074_10772302 | 3300014877 | Soil | SDYIERYAHAPATWGDYLELFGGERLARQQKKARELT* |
| Ga0137418_104139901 | 3300015241 | Vadose Zone Soil | ARGPEAAVGEYLARYVYGPPTWDDYLELFGGERLAKQRALAKELTS* |
| Ga0137409_112035532 | 3300015245 | Vadose Zone Soil | PEAAVGDYLRRYVYGPTTWDAYLELFGGERLARQRKLARELTS* |
| Ga0134085_104723511 | 3300015359 | Grasslands Soil | IDARGPAAVADYLERYAYAPPTWGDYLDLFGGERLALQRRRARELVG* |
| Ga0134085_105352102 | 3300015359 | Grasslands Soil | EYTAAIDARGPAAVAEYLERYVYTPPTWNDYLDLFGGERLALQAKRAKELTR* |
| Ga0184626_101086611 | 3300018053 | Groundwater Sediment | ARGPAAVGEYLERYVYGPPAWNDYLDLFGGERLALQAKRARELTR |
| Ga0187766_106506271 | 3300018058 | Tropical Peatland | AIDARGPAAVGEYLERYVYGPPTWSDYLDLFGGERMAALAKQAKELTR |
| Ga0184640_101528321 | 3300018074 | Groundwater Sediment | YVAAIDAQGPQAVTDYIARYVDAPATYADYLDLFGGERLARQQRAARELVER |
| Ga0137408_13335731 | 3300019789 | Vadose Zone Soil | HFADYTPRAIDARGPAAVADYLERYAYAPPTWGDYLDLFGGERLALQQRRARELTGE |
| Ga0179594_100311003 | 3300020170 | Vadose Zone Soil | AVGDYLERYVYGPPTWSDYLDLFGGERLALQAKRAKELTR |
| Ga0209641_103347001 | 3300025322 | Soil | LERYVYGPPTWADYLELFGGARLALQAKRARELTRV |
| Ga0209235_10486871 | 3300026296 | Grasslands Soil | ADYLERYAYAPPTWSDYLDLFGGERLALQGRRARELTGL |
| Ga0209236_11674832 | 3300026298 | Grasslands Soil | AIDARGPAAVADYLERYAYAPPTWSDYLDLFGGERLALQGRRARELTGL |
| Ga0209686_11345572 | 3300026315 | Soil | DHFAEYTASIDARGPEAAVGEYLARHVYGPPTWDDYLELFGGERLARQRAAAKELTG |
| Ga0209154_12881441 | 3300026317 | Soil | AIDARGPAAVGDYLERYVYGPPTWSDYLELFGGERMGLQAKRARELTR |
| Ga0209470_10938981 | 3300026324 | Soil | TASIDARGPEATVGEYLARYVYGPPTWDDYLELFGGERLARQRAAARELTA |
| Ga0209802_12114702 | 3300026328 | Soil | AAVGEYLARYVYGPPTWDDYLELFGGERLARQRAAARELTA |
| Ga0209803_10888683 | 3300026332 | Soil | YLARYVYGPPTWDDYLELFGGERLARQRAAARELTA |
| Ga0209158_10873121 | 3300026333 | Soil | GPAAVGEYLERYVYGPPAWSDYLDLFGGERLALQAKRAKELTR |
| Ga0209377_10506943 | 3300026334 | Soil | DYLERYVYGPPTWSDYLDLFGGERMALQAKRAKELTR |
| Ga0209057_10053411 | 3300026342 | Soil | ADYLERYVYAPPTWGDYLDLFGGERLALQQRRARELVGA |
| Ga0209818_10423113 | 3300027637 | Agricultural Soil | LYEADYDHFADYTAAIDARGPQAVIEYLARYVDAPATYDDYLELFGGERLAQQRARARELTA |
| Ga0209076_10973871 | 3300027643 | Vadose Zone Soil | AVGEYLARYVYGPPTWDDYLELFGGERLAKQRALAKELTS |
| Ga0209689_13376662 | 3300027748 | Soil | PAAVADYLERYAYTPPTWDDYLDLFGGERLARQQRRARELVGK |
| Ga0209283_100926653 | 3300027875 | Vadose Zone Soil | LERYVYGPPAWNDYLDLFGGERLALQAKRARELTR |
| (restricted) Ga0233417_106204841 | 3300028043 | Sediment | DARGPAAVADYLDRYAFGPPTFNDYLDLFGGARLAAQQKKARELTRIR |
| Ga0307504_102847111 | 3300028792 | Soil | AVADYLERYVYGPPTWNDYLDLFGGERMAIQAKRAKELTR |
| Ga0299907_104460343 | 3300030006 | Soil | AYLDRYVDGPPTHADYLALFGGERLALQQARARELTG |
| Ga0318528_103290921 | 3300031561 | Soil | AEYCAAIDARGPAAVGEYLERYVYGPPTWSDYLDLFGGERMAALAKQAKELTR |
| Ga0310813_101512643 | 3300031716 | Soil | RGPAAAVGDYLARYVDAPATWDAYLDLFGGERLARQQAFARELTQ |
| Ga0307469_111992972 | 3300031720 | Hardwood Forest Soil | ARGPRAVGEYLERYVYRPPAWTDYLDLFGGERLALQAKRAKELTR |
| Ga0307468_1021317131 | 3300031740 | Hardwood Forest Soil | IDARGPSAVGDYLERYVYGPPTWNDYLDLFGGERMARQVKQAKELTR |
| Ga0306918_114800041 | 3300031744 | Soil | YEHFAEYCAAIDARGPAAVGEYLERYVYGPPTWSDYLDLFGGERMAALAKQAKELTR |
| Ga0318535_101245311 | 3300031764 | Soil | AAVGEYLERYVYGPPTWSDYLDLFGGERMAALAKQAKELTR |
| Ga0310899_107391812 | 3300032017 | Soil | CAAIDRSGPAAVGDYLERYVYGPPTWSDYLDLFGGERMALQVKRAKELTR |
| Ga0310811_103532674 | 3300033475 | Soil | EYTASVEARGPAAAVGDYLARYVDAPATWDAYLDLFGGERLARQQAFARELTQ |
| Ga0364940_0149313_2_157 | 3300034164 | Sediment | TAAIDARGPAAAVGDYLQRHVYGPPTWDDYLELFGGARLAKQRKLARELTS |
| ⦗Top⦘ |