


| Basic Information | |
|---|---|
| Family ID | F105702 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 42 residues |
| Representative Sequence | EANRLYLQGGKKMIGASDQERRLQRLQEIMDELMSLTDWKKT |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.01 % |
| % of genes near scaffold ends (potentially truncated) | 98.00 % |
| % of genes from short scaffolds (< 2000 bps) | 91.00 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (12.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (36.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.71% β-sheet: 0.00% Coil/Unstructured: 54.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF00488 | MutS_V | 4.00 |
| PF03795 | YCII | 3.00 |
| PF00072 | Response_reg | 2.00 |
| PF02201 | SWIB | 2.00 |
| PF01713 | Smr | 2.00 |
| PF13414 | TPR_11 | 1.00 |
| PF03796 | DnaB_C | 1.00 |
| PF01548 | DEDD_Tnp_IS110 | 1.00 |
| PF09624 | DUF2393 | 1.00 |
| PF13428 | TPR_14 | 1.00 |
| PF02371 | Transposase_20 | 1.00 |
| PF14559 | TPR_19 | 1.00 |
| PF02517 | Rce1-like | 1.00 |
| PF13237 | Fer4_10 | 1.00 |
| PF03648 | Glyco_hydro_67N | 1.00 |
| PF02423 | OCD_Mu_crystall | 1.00 |
| PF00903 | Glyoxalase | 1.00 |
| PF12838 | Fer4_7 | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0249 | DNA mismatch repair ATPase MutS | Replication, recombination and repair [L] | 4.00 |
| COG1193 | dsDNA-specific endonuclease/ATPase MutS2 | Replication, recombination and repair [L] | 4.00 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 3.00 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 2.00 |
| COG5531 | DNA-binding SWIB/MDM2 domain | Chromatin structure and dynamics [B] | 2.00 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 1.00 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 1.00 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 1.00 |
| COG2423 | Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family | Amino acid transport and metabolism [E] | 1.00 |
| COG3661 | Alpha-glucuronidase | Carbohydrate transport and metabolism [G] | 1.00 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.00 % |
| Unclassified | root | N/A | 13.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001356|JGI12269J14319_10278679 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300004082|Ga0062384_100420559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 866 | Open in IMG/M |
| 3300004617|Ga0068955_1361532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300005177|Ga0066690_10507664 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300005180|Ga0066685_10580944 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300005184|Ga0066671_10248487 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300005435|Ga0070714_101581467 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
| 3300005548|Ga0070665_102133850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300005555|Ga0066692_10906125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300005557|Ga0066704_10254527 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
| 3300005578|Ga0068854_101601254 | Not Available | 593 | Open in IMG/M |
| 3300005587|Ga0066654_10282760 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300005616|Ga0068852_101167917 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300005921|Ga0070766_10008779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 5164 | Open in IMG/M |
| 3300006059|Ga0075017_101167336 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300006059|Ga0075017_101430724 | Not Available | 544 | Open in IMG/M |
| 3300006173|Ga0070716_101424715 | Not Available | 564 | Open in IMG/M |
| 3300009038|Ga0099829_11720806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300009089|Ga0099828_10438755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1177 | Open in IMG/M |
| 3300009137|Ga0066709_103356973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300009522|Ga0116218_1215963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 864 | Open in IMG/M |
| 3300009522|Ga0116218_1527867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300009523|Ga0116221_1101643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1271 | Open in IMG/M |
| 3300009552|Ga0116138_1031889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1574 | Open in IMG/M |
| 3300009621|Ga0116116_1088201 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300009624|Ga0116105_1130616 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300009635|Ga0116117_1009266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2572 | Open in IMG/M |
| 3300009639|Ga0116122_1018890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2495 | Open in IMG/M |
| 3300009645|Ga0116106_1191126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300009839|Ga0116223_10343745 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 884 | Open in IMG/M |
| 3300010396|Ga0134126_13099898 | Not Available | 501 | Open in IMG/M |
| 3300011271|Ga0137393_10802718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 804 | Open in IMG/M |
| 3300012096|Ga0137389_10814594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 802 | Open in IMG/M |
| 3300012200|Ga0137382_10419289 | Not Available | 945 | Open in IMG/M |
| 3300012210|Ga0137378_10350803 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1371 | Open in IMG/M |
| 3300012918|Ga0137396_10417668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 994 | Open in IMG/M |
| 3300012925|Ga0137419_10056206 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2562 | Open in IMG/M |
| 3300012925|Ga0137419_11201252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
| 3300014155|Ga0181524_10356524 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
| 3300014200|Ga0181526_10646995 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300014495|Ga0182015_10286685 | Not Available | 1080 | Open in IMG/M |
| 3300015245|Ga0137409_10920327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 711 | Open in IMG/M |
| 3300016750|Ga0181505_10622273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
| 3300017932|Ga0187814_10044671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1633 | Open in IMG/M |
| 3300017933|Ga0187801_10058720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1410 | Open in IMG/M |
| 3300017935|Ga0187848_10370239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300017937|Ga0187809_10094408 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300017938|Ga0187854_10204300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 872 | Open in IMG/M |
| 3300017959|Ga0187779_10565720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
| 3300017995|Ga0187816_10114950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1158 | Open in IMG/M |
| 3300018002|Ga0187868_1241698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300018034|Ga0187863_10468698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
| 3300018035|Ga0187875_10562315 | Not Available | 603 | Open in IMG/M |
| 3300018037|Ga0187883_10339315 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
| 3300018037|Ga0187883_10526361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
| 3300018043|Ga0187887_10383066 | Not Available | 830 | Open in IMG/M |
| 3300018062|Ga0187784_11167368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300018090|Ga0187770_11464235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300018433|Ga0066667_11477956 | Not Available | 600 | Open in IMG/M |
| 3300019788|Ga0182028_1149855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1326 | Open in IMG/M |
| 3300019888|Ga0193751_1053063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1735 | Open in IMG/M |
| 3300020022|Ga0193733_1176075 | Not Available | 564 | Open in IMG/M |
| 3300020199|Ga0179592_10204835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 894 | Open in IMG/M |
| 3300020582|Ga0210395_10087272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2302 | Open in IMG/M |
| 3300020583|Ga0210401_10358007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1321 | Open in IMG/M |
| 3300021168|Ga0210406_11356719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300021181|Ga0210388_10510047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1055 | Open in IMG/M |
| 3300021181|Ga0210388_11124022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300021433|Ga0210391_11449153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300021445|Ga0182009_10661325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 563 | Open in IMG/M |
| 3300022509|Ga0242649_1066341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300022726|Ga0242654_10449356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300025406|Ga0208035_1019349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1100 | Open in IMG/M |
| 3300025448|Ga0208037_1025173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1338 | Open in IMG/M |
| 3300025453|Ga0208455_1001253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8338 | Open in IMG/M |
| 3300025453|Ga0208455_1057559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 811 | Open in IMG/M |
| 3300025480|Ga0208688_1057429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 822 | Open in IMG/M |
| 3300025506|Ga0208937_1041223 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1103 | Open in IMG/M |
| 3300025898|Ga0207692_10676561 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300026315|Ga0209686_1115357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 908 | Open in IMG/M |
| 3300026351|Ga0257170_1051124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300026532|Ga0209160_1174996 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300027862|Ga0209701_10263527 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300027889|Ga0209380_10011296 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5174 | Open in IMG/M |
| 3300027911|Ga0209698_11055765 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
| 3300028798|Ga0302222_10188590 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300028906|Ga0308309_11567381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300029920|Ga0302142_1256347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300029951|Ga0311371_12476450 | Not Available | 529 | Open in IMG/M |
| 3300030053|Ga0302177_10169554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1219 | Open in IMG/M |
| 3300030741|Ga0265459_13388026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300031057|Ga0170834_109288914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300031234|Ga0302325_12159455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
| 3300031446|Ga0170820_17395812 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300031474|Ga0170818_103678996 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300031720|Ga0307469_10051745 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2586 | Open in IMG/M |
| 3300031962|Ga0307479_10423720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1315 | Open in IMG/M |
| 3300033405|Ga0326727_10424569 | Not Available | 1203 | Open in IMG/M |
| 3300033405|Ga0326727_10897132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 12.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 9.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.00% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.00% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.00% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.00% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 2.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.00% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.00% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.00% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.00% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004617 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 47 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009621 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
| 3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018002 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300022509 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025406 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025448 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025453 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025480 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025506 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029920 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_3 | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12269J14319_102786791 | 3300001356 | Peatlands Soil | IAEISAANRLYLQGGKKTIGASDQERRLQRLQEIMDELMSLTDWKKP* |
| Ga0062384_1004205592 | 3300004082 | Bog Forest Soil | ISEANRLYLQGGKKMIGASDQERRLQRLQEIMDELMSLTEWKKT* |
| Ga0068955_13615322 | 3300004617 | Peatlands Soil | NRLYLQGGKKMIGASDQARRLQRLQEIMDELMSLTDWKKP* |
| Ga0066690_105076641 | 3300005177 | Soil | EEIAQIAGANRFYLQSGKRTADAADHQRRLQRLQEILDELMSLTDWKKP* |
| Ga0066685_105809441 | 3300005180 | Soil | VYVQGGRKTPSVATDHERRMQRLEEILDELMSLTDWKKP* |
| Ga0066671_102484872 | 3300005184 | Soil | AQIAGANRFYLQSGKRTADAADHQRRLQRLQEILDELMSLTDWKKP* |
| Ga0070714_1015814671 | 3300005435 | Agricultural Soil | ISAANRQYLEGGKKIPGASDHERRLQRLQEILDELMSLTDWKKP* |
| Ga0070665_1021338501 | 3300005548 | Switchgrass Rhizosphere | IREANRLYLQGGKKIPGAADQERRLQRLQEILDELISLTDWKKP* |
| Ga0066692_109061252 | 3300005555 | Soil | GGKKEPGAASDQERRLQRLQAILDELVSLTDWKRT* |
| Ga0066704_102545273 | 3300005557 | Soil | EEIAQIREANRLYLQGGKKEPGAASDQERRLQRLQAILDELVSLTDWKRT* |
| Ga0068854_1016012542 | 3300005578 | Corn Rhizosphere | GGSKSAVAAADQERRLQRLQAIMDELMSLNDWKKV* |
| Ga0066654_102827601 | 3300005587 | Soil | IAQIAGANRFYLQSGKRTADAADHQRRLQRLQEILDELMSLTDWKKP* |
| Ga0068852_1011679173 | 3300005616 | Corn Rhizosphere | QIREANRLYLQGGKRIPGAADQERRLQRLQEILDELMSLTDWKKP* |
| Ga0070766_100087791 | 3300005921 | Soil | NRLYLQGGKKLIGASDQERRLQRLQEIMDELMSLTDWKKT* |
| Ga0075023_1000208093 | 3300006041 | Watersheds | HMKGGKKIPGAADHERRLQRLQEILDELMSLTDWKKP* |
| Ga0075017_1011673362 | 3300006059 | Watersheds | LYLQGGKKVIGASDQERRLQRLQEIMDELMSLTDWKKP* |
| Ga0075017_1014307241 | 3300006059 | Watersheds | IRGANRLYLQGGKKVVGAADQERRLQRLQEILDELMLLTDWKKL* |
| Ga0070716_1014247152 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | IREANRLYLQSGKKPPGAADHERRRERLQEIVDELAALTDWKKP* |
| Ga0099829_117208062 | 3300009038 | Vadose Zone Soil | LQGGKKIIGASDQERRLQRLQEIMDELMSLTDWKKT* |
| Ga0099828_104387551 | 3300009089 | Vadose Zone Soil | YLQGGKKIIGASDQERRLQRLQEIMDELMSLTDWKKP* |
| Ga0066709_1033569732 | 3300009137 | Grasslands Soil | RNANQLYIQAGKKVLDAAEQERRIQRLQEILDELMSLTDWKKP* |
| Ga0116218_12159631 | 3300009522 | Peatlands Soil | YLQGGKKMIGASDQERRLQRLQEIMDELMSLTDWKKT* |
| Ga0116218_15278671 | 3300009522 | Peatlands Soil | IAEISEANRLYLQGGKKMIGASDQERRLQRLQEIMDELMSLTDWKKP* |
| Ga0116221_11016431 | 3300009523 | Peatlands Soil | EEIAEISAANRLYLQGGKKTIGASDQERRLQRLQEIMDELMSLTDWKKP* |
| Ga0116138_10318891 | 3300009552 | Peatland | SAANRLYLQGGKKTIGASDQERRLQRLQEIMDELMSLTDWKKP* |
| Ga0116116_10882013 | 3300009621 | Peatland | EISEANRLYLQGGKKTIGASDQQRRLQRLQEIMDELMSLTDWKKT* |
| Ga0116105_11306161 | 3300009624 | Peatland | GGKKLIGASDQERRLQRLQEIMDELMSLTEWKKT* |
| Ga0116117_10092661 | 3300009635 | Peatland | AEISEANRLYLAGGKKLIGASDQERRLQRLQEIMDELKSLTDWKKT* |
| Ga0116122_10188901 | 3300009639 | Peatland | QGGKKTIGASDQQRRLQRLQEIMDELMSLTDWKKT* |
| Ga0116106_11911262 | 3300009645 | Peatland | YLQGGKKMIGASDQERRLQRLQEIMDELMSLTDWKKP* |
| Ga0116223_103437451 | 3300009839 | Peatlands Soil | SEANRLYLQGGKKMIGASDQERRLQRLQEIMDELMSLTEWKKT* |
| Ga0134126_130998981 | 3300010396 | Terrestrial Soil | FKGRKKADGAADHQRRLERLQQILYELMSLTDWKKP* |
| Ga0137393_108027181 | 3300011271 | Vadose Zone Soil | ISEANRLYLQGGKKIIGASDQERRLQRLQEIMNELMSLTDWKKT* |
| Ga0137389_108145941 | 3300012096 | Vadose Zone Soil | SEANRQYLQGGKKMIGASDQERRLQRLQEIMDELMSLTDWKKP* |
| Ga0137382_104192891 | 3300012200 | Vadose Zone Soil | AQIRGANRLYLQGGKKVVGAADQERRLQRLQEILDELMLLTEWKKL* |
| Ga0137378_103508036 | 3300012210 | Vadose Zone Soil | EANKLHLQSAKTPLAVAEQQRRLQRLQEILDELMALTDWKKT* |
| Ga0137396_104176681 | 3300012918 | Vadose Zone Soil | ANRLYLQGGKKIIGASDQERRLQRLQEIMDELMSLTDWKKT* |
| Ga0137419_100562061 | 3300012925 | Vadose Zone Soil | LYFEGGKKAVAAADHQRRLERLQAIRDELMSLTDWKKT* |
| Ga0137419_112012521 | 3300012925 | Vadose Zone Soil | ISAANREYTERGKKIPGAADHERRLQRLQEILDELMSLTDWKKQ* |
| Ga0181524_103565242 | 3300014155 | Bog | EIAEISEANRQYLQGGKKPIGASDQERRLQRLQEIMDELMSLTDWKKP* |
| Ga0181526_106469952 | 3300014200 | Bog | EANRLYLQGGKKMIGASDQERRLQRLQEIMDELMSLTEWKKT* |
| Ga0182015_102866851 | 3300014495 | Palsa | RLYLQGGKKIPQGSDQERRLQRLQEILDELGALTEWKKL* |
| Ga0137409_109203271 | 3300015245 | Vadose Zone Soil | GGKKIIGASDQERRLQRLQEIMDELMSLTDWKKT* |
| Ga0181505_106222733 | 3300016750 | Peatland | EEIAEISEANRQYLQGGKKMVGASDQERRLQRLQEIMDELMSLTDWKKP |
| Ga0187814_100446714 | 3300017932 | Freshwater Sediment | EGGKKMVGASDQERRQQRLQEIMDELKSLTDWKKT |
| Ga0187801_100587203 | 3300017933 | Freshwater Sediment | LKGGKKPPGAPDQERRLQRLQEILDELMSLTDWKKP |
| Ga0187848_103702391 | 3300017935 | Peatland | QGGKKTIGASDQQRRLQRLQEIMDELMSLTDWKKT |
| Ga0187809_100944081 | 3300017937 | Freshwater Sediment | EIAQINAANRLYLQSGKKPPGGADHERRRERLQQILDELVGLTDWKKL |
| Ga0187854_102043001 | 3300017938 | Peatland | QGGKKMIGASDQERRLQRLQEIMDELLSLTDWKKP |
| Ga0187779_105657203 | 3300017959 | Tropical Peatland | VEIAEISEANRLYLQGGKKVVGASDQERRLQRLQEIMDELMSLTDWKKT |
| Ga0187816_101149501 | 3300017995 | Freshwater Sediment | YLQGGKKMVGASDQERRLQRLQEIMDELMSLTDWKKT |
| Ga0187868_12416981 | 3300018002 | Peatland | NRQYLQGGKKTIGASDQERRLQRLQEIMDELSSLTDWKKT |
| Ga0187863_104686981 | 3300018034 | Peatland | NRLYLQGGKKMIGASDQERRLQRLQEIMDELMSLTEWKKT |
| Ga0187875_105623152 | 3300018035 | Peatland | EANRLYLQGGKKMIGASDQQRRLQRLQEIMDELMSLTEWKKT |
| Ga0187883_103393151 | 3300018037 | Peatland | REEIAEISEANRLYLQGGKKMIGASDQERRLQRLQEIMDELMSLTDWKKT |
| Ga0187883_105263611 | 3300018037 | Peatland | NRLYLQGGKKMVGASDHERRLQRLQEIMDELRSLTDWKKT |
| Ga0187887_103830663 | 3300018043 | Peatland | RLYLQGGKKMIGASDQERRLQRLQEIMDELMSLTEWKKT |
| Ga0187784_111673681 | 3300018062 | Tropical Peatland | NRLYVQGGKKTIGASDQERRLQRLQEIMDELMSLTDWKKP |
| Ga0187770_114642352 | 3300018090 | Tropical Peatland | LYVQGGKKTIGASDQERRLQRLQEIMDELMSLTDWKKP |
| Ga0066667_114779561 | 3300018433 | Grasslands Soil | LQGGKKVVGAADQERRLQRLQEILDELMLLTEWKKL |
| Ga0182028_11498554 | 3300019788 | Fen | YLHGGKKAIGASDQERRLQRLQEIMDELMSLTDWKKT |
| Ga0193751_10530631 | 3300019888 | Soil | EANRQYLQGGKKMIGASDQERRLQRLQEIMDELMSLTEWKKT |
| Ga0193733_11760752 | 3300020022 | Soil | RLYLQDGKKAVAAADHQRRLERLQAIRDELRSLTDWKKT |
| Ga0179592_102048353 | 3300020199 | Vadose Zone Soil | REEIAEISEANRQYLQGGKKMIGASDQERRIQRLQEIMDELMSLTDWKKT |
| Ga0210395_100872724 | 3300020582 | Soil | EANRLYLQGGKKMIGASDQERRLQRLQEIMDELMSLTDWKKT |
| Ga0210401_103580074 | 3300020583 | Soil | IAEISEANRLYLQGGKKLIGASDQERRLQRLQEIMDELMSLTDWKKT |
| Ga0210406_113567191 | 3300021168 | Soil | EEIAEISEANRLYLQGGKKIIGASDQERRLQRLQEIMDELMSLTDWKKT |
| Ga0210388_105100471 | 3300021181 | Soil | KCREEIAEISEANRLYLQGGKKVVGASDQERRLQRLQEIMDELMALTDWKKP |
| Ga0210388_111240221 | 3300021181 | Soil | MYLQGGKKVVGASDQERRLQRLQEIMDELRSLTDWKKP |
| Ga0210391_114491532 | 3300021433 | Soil | QGGKKMIGATDQERRLQRLQEIMDELMSLTDWKKT |
| Ga0182009_106613251 | 3300021445 | Soil | RLYLLGGKRIPGAAEDHQRRMQRLQEIMDELKSLTDWKKT |
| Ga0242649_10663411 | 3300022509 | Soil | RQYLHGGKKKLSGAAGDHQRRLQRLQDILDELMSLTDWKKV |
| Ga0242654_104493561 | 3300022726 | Soil | LQGGKKIIGASDQERRLQRLQEIMDELMSLTDWKKT |
| Ga0208035_10193491 | 3300025406 | Peatland | AEISEANRLYLAGGKKLIGASDQERRLQRLQEIMDELKSLTDWKKT |
| Ga0208037_10251734 | 3300025448 | Peatland | YLQGGKKTIGASDQQRRLQRLQEIMDELMSLTDWKKT |
| Ga0208455_10012537 | 3300025453 | Peatland | ISEANRLYLQGGKKTIGASDQQRRLQRLQEIMDELMSLTDWKKT |
| Ga0208455_10575591 | 3300025453 | Peatland | SAANRLYLQGGKKTIGASDQERRLQRLQEIMDELMSLTDWKKP |
| Ga0208688_10574293 | 3300025480 | Peatland | QYLQGGKKMIGASDQERRLQRLQEIMDELMSLTDWKKP |
| Ga0208937_10412234 | 3300025506 | Peatland | ANRQYLQGGKKMIGASDQERRLQRLQEIMDELMSLTDWKKP |
| Ga0207692_106765611 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | IAQIREANRLYVQGGDKRPGTAPDQERRLQRLQEILDELMSLTEWKKT |
| Ga0209686_11153573 | 3300026315 | Soil | YIQAGKKVLDAAEQERRIQRLQEILDELMSLTDWKKP |
| Ga0257170_10511241 | 3300026351 | Soil | IAEISEANRQYLQGGKKMIGASDQERRLQRLQEIMDELMSLTDWKKP |
| Ga0209160_11749961 | 3300026532 | Soil | IAQIREANRLYLQGGKKEPGAASDQERRLQRLQAILDELVSLTDWKRT |
| Ga0209701_102635271 | 3300027862 | Vadose Zone Soil | EIAQISEANRLYLQGGKKIPGAADQERRLQRLQEILDELMSLTDWRKQ |
| Ga0209380_100112965 | 3300027889 | Soil | SEANRLYLQGGKKLIGASDQERRLQRLQEIMDELMSLTDWKKT |
| Ga0209698_110557652 | 3300027911 | Watersheds | EIAEISAANRLYLQGGKKMIGASDQERRLQRLQEIMDELMSLTDWKKP |
| Ga0302222_101885901 | 3300028798 | Palsa | EANRQYLQGGKKMIGASDQERRLQRLQEIMDELMSLTDWKKT |
| Ga0308309_115673811 | 3300028906 | Soil | IAQISEANRQYLHGGKKKLSGAAGDHQRRLQRLQDILDELMSLTDWKKL |
| Ga0302142_12563471 | 3300029920 | Bog | NRLYLAGGKKMIGAADQERRLQRLQEIMDELMSLTEWKKT |
| Ga0311371_124764501 | 3300029951 | Palsa | REEIAEISEANRLYLQGGKKMIGASDQERRLQRLQEIMDELMSLTEWKKT |
| Ga0302177_101695541 | 3300030053 | Palsa | QYLQGGKKAIGASDQERRLQRLQEIMDELMSLTDWKKP |
| Ga0265459_133880262 | 3300030741 | Soil | REEIAEISEANRLYLQGGKKVVGASDQERRLQRLQEIMDELMALTDWKKP |
| Ga0170834_1092889141 | 3300031057 | Forest Soil | LQGGKKMIGASDQERRIQRLQEIMDELMSLTDWKKT |
| Ga0302325_121594552 | 3300031234 | Palsa | NRQYLEGGKKMIGASDQERRLQRLQEIMDELMSLTDWKKT |
| Ga0170820_173958123 | 3300031446 | Forest Soil | QGGSRSVVAAADQERRLQRLQAIMDELMSLTDWKKV |
| Ga0170818_1036789962 | 3300031474 | Forest Soil | EISEANRLYQQGGKRISGSASDQERRVQRVQEILDKIMSLTDWKKP |
| Ga0307469_100517451 | 3300031720 | Hardwood Forest Soil | IAEISEANRLYLQGGKKMIGASDQERRLQRLQEIMDELMSLTDWKKP |
| Ga0307479_104237201 | 3300031962 | Hardwood Forest Soil | ANRLYLQGGKKIIGASDQERRLQRLQEIMDELMSLTDWKKT |
| Ga0326727_104245691 | 3300033405 | Peat Soil | AEIAEISEANRLYLQGGKKVIGASDQQRRLQRLQEIMDELMSLTDWKKT |
| Ga0326727_108971321 | 3300033405 | Peat Soil | EANRLYLEGGKKMIGASDQQRRLQRLQEIMDELMSLTDWKKT |
| ⦗Top⦘ |