


| Basic Information | |
|---|---|
| Family ID | F105698 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 43 residues |
| Representative Sequence | EAGSGDYFLFHYTNVMKNLKISESKFKQDWPKGVSRVKPRA |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.01 % |
| % of genes near scaffold ends (potentially truncated) | 98.00 % |
| % of genes from short scaffolds (< 2000 bps) | 84.00 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.22 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (28.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (40.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.59% β-sheet: 0.00% Coil/Unstructured: 88.41% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF01035 | DNA_binding_1 | 45.00 |
| PF12833 | HTH_18 | 25.00 |
| PF02870 | Methyltransf_1N | 10.00 |
| PF00892 | EamA | 5.00 |
| PF13419 | HAD_2 | 2.00 |
| PF02805 | Ada_Zn_binding | 1.00 |
| PF03328 | HpcH_HpaI | 1.00 |
| PF13570 | PQQ_3 | 1.00 |
| PF13565 | HTH_32 | 1.00 |
| PF13620 | CarboxypepD_reg | 1.00 |
| PF07238 | PilZ | 1.00 |
| PF12390 | Se-cys_synth_N | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0350 | DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase) | Replication, recombination and repair [L] | 55.00 |
| COG3695 | Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domain | Transcription [K] | 45.00 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 1.00 |
| COG2169 | Methylphosphotriester-DNA--protein-cysteine methyltransferase (N-terminal fragment of Ada), contains Zn-binding and two AraC-type DNA-binding domains | Replication, recombination and repair [L] | 1.00 |
| COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 1.00 |
| COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.00 % |
| Unclassified | root | N/A | 3.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352024|deeps__Contig_146870 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300001593|JGI12635J15846_10422161 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300004080|Ga0062385_10659601 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300004092|Ga0062389_100094331 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2621 | Open in IMG/M |
| 3300005172|Ga0066683_10289765 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1017 | Open in IMG/M |
| 3300005367|Ga0070667_100843540 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300005434|Ga0070709_11412224 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300005444|Ga0070694_101310101 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300005537|Ga0070730_10911195 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300005541|Ga0070733_10314307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1036 | Open in IMG/M |
| 3300005542|Ga0070732_10198087 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1200 | Open in IMG/M |
| 3300005718|Ga0068866_10037317 | All Organisms → cellular organisms → Bacteria | 2386 | Open in IMG/M |
| 3300006046|Ga0066652_100982648 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300006050|Ga0075028_100329177 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300006173|Ga0070716_101566904 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300006176|Ga0070765_100163479 | All Organisms → cellular organisms → Bacteria | 1996 | Open in IMG/M |
| 3300006176|Ga0070765_101187871 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300006800|Ga0066660_10901632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300006806|Ga0079220_11991968 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300006903|Ga0075426_10647869 | Not Available | 790 | Open in IMG/M |
| 3300007265|Ga0099794_10274031 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300009012|Ga0066710_102775758 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300009093|Ga0105240_12453974 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300010043|Ga0126380_11819344 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300010398|Ga0126383_13502336 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300011120|Ga0150983_13938907 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300011269|Ga0137392_10138542 | All Organisms → cellular organisms → Bacteria | 1956 | Open in IMG/M |
| 3300011269|Ga0137392_11228242 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300011270|Ga0137391_10299338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1388 | Open in IMG/M |
| 3300011270|Ga0137391_11116246 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300012096|Ga0137389_10018517 | All Organisms → cellular organisms → Bacteria | 4846 | Open in IMG/M |
| 3300012198|Ga0137364_10298433 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1196 | Open in IMG/M |
| 3300012202|Ga0137363_10478409 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1044 | Open in IMG/M |
| 3300012202|Ga0137363_10710600 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300012202|Ga0137363_11783095 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300012205|Ga0137362_11776514 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300012210|Ga0137378_10966166 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300012210|Ga0137378_11404384 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300012285|Ga0137370_10408526 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 823 | Open in IMG/M |
| 3300012361|Ga0137360_10088198 | All Organisms → cellular organisms → Bacteria | 2345 | Open in IMG/M |
| 3300012685|Ga0137397_10336428 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300012925|Ga0137419_11352453 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300012930|Ga0137407_10000537 | All Organisms → cellular organisms → Bacteria | 25322 | Open in IMG/M |
| 3300012930|Ga0137407_10029716 | All Organisms → cellular organisms → Bacteria | 4243 | Open in IMG/M |
| 3300012930|Ga0137407_10099405 | All Organisms → cellular organisms → Bacteria | 2490 | Open in IMG/M |
| 3300012931|Ga0153915_11955631 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300012971|Ga0126369_12232884 | Not Available | 634 | Open in IMG/M |
| 3300017943|Ga0187819_10660990 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300020034|Ga0193753_10225687 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300020579|Ga0210407_10057493 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2909 | Open in IMG/M |
| 3300021086|Ga0179596_10106531 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1282 | Open in IMG/M |
| 3300021168|Ga0210406_10587513 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300021171|Ga0210405_10320946 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1223 | Open in IMG/M |
| 3300021178|Ga0210408_11501025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300021180|Ga0210396_11395844 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300021420|Ga0210394_10002077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 28742 | Open in IMG/M |
| 3300021477|Ga0210398_10273840 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1376 | Open in IMG/M |
| 3300021478|Ga0210402_10137706 | All Organisms → cellular organisms → Bacteria | 2217 | Open in IMG/M |
| 3300021478|Ga0210402_11436447 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300021478|Ga0210402_11848759 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300021479|Ga0210410_10235856 | All Organisms → cellular organisms → Bacteria | 1640 | Open in IMG/M |
| 3300021479|Ga0210410_10954806 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300021559|Ga0210409_10941559 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300022714|Ga0242671_1071473 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300025898|Ga0207692_10879160 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300025906|Ga0207699_11131533 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300025916|Ga0207663_10695281 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300025986|Ga0207658_10697864 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300026035|Ga0207703_11288548 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300026301|Ga0209238_1069409 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1241 | Open in IMG/M |
| 3300026313|Ga0209761_1032493 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3115 | Open in IMG/M |
| 3300026508|Ga0257161_1111858 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300026555|Ga0179593_1023485 | All Organisms → cellular organisms → Bacteria | 2614 | Open in IMG/M |
| 3300026557|Ga0179587_10648618 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300027671|Ga0209588_1250825 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300027783|Ga0209448_10224867 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300027846|Ga0209180_10220750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1092 | Open in IMG/M |
| 3300027853|Ga0209274_10714751 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300027862|Ga0209701_10364354 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300027875|Ga0209283_10071285 | All Organisms → cellular organisms → Bacteria | 2238 | Open in IMG/M |
| 3300027884|Ga0209275_10541569 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300027903|Ga0209488_10623076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 780 | Open in IMG/M |
| 3300027910|Ga0209583_10018409 | All Organisms → cellular organisms → Bacteria | 2177 | Open in IMG/M |
| 3300029636|Ga0222749_10726306 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300030862|Ga0265753_1036522 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300031057|Ga0170834_111662168 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300031231|Ga0170824_103515647 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300031231|Ga0170824_125612505 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300031234|Ga0302325_10266412 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2829 | Open in IMG/M |
| 3300031446|Ga0170820_13201078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300031715|Ga0307476_10347036 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1092 | Open in IMG/M |
| 3300031753|Ga0307477_11056229 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300031754|Ga0307475_11473044 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300031799|Ga0318565_10119105 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1273 | Open in IMG/M |
| 3300031820|Ga0307473_11127821 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300031962|Ga0307479_10628395 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1055 | Open in IMG/M |
| 3300031962|Ga0307479_11843236 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300032180|Ga0307471_102896614 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300032205|Ga0307472_100521782 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 28.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 8.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.00% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.00% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.00% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.00% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022714 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deeps_02690340 | 2199352024 | Soil | SSSWLPVQQKFYESGSADYIQFHYSNVMKNLKIPDFRFKPDWPKDVTRVRPGM |
| JGI12635J15846_104221611 | 3300001593 | Forest Soil | DEASWLPIQQKFFESGSEDYLIFHYTNVMKNLKIGDNQFKQDWPKGVTRTKLRS* |
| Ga0062385_106596012 | 3300004080 | Bog Forest Soil | PLQQKFYETGAGDYIQFHYTNMMKNLKINESRFKQDWPKNASHEKPRA* |
| Ga0062389_1000943311 | 3300004092 | Bog Forest Soil | YETGAGDYILFHYTNMMKNLKINESEFKQNWPKNASHEKPHV* |
| Ga0066683_102897652 | 3300005172 | Soil | IQQKFFEAGSGDYVLSHYTNVMKNLKINDAKFKQDWPKSVSRVKPRA* |
| Ga0070667_1008435401 | 3300005367 | Switchgrass Rhizosphere | WLPVQQKFYESGSADYIQFHYSNVMKNLKIPDSRFKQDWPKDATRVKPGM* |
| Ga0070709_114122242 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | SGSADYIQFHYSNVMKNLKIPDSRFKQDWPKDATRVKPGI* |
| Ga0070694_1013101012 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | LPVQQKFYESGSADYIQFHYSNVMKNLKIPDSRFKQDWPKDATRVKPGM* |
| Ga0070730_109111953 | 3300005537 | Surface Soil | QQKFFEAGSGDYFLFHYTNEMKNLKVGDKEFKQDWPKGVTRVKPRG* |
| Ga0070733_103143072 | 3300005541 | Surface Soil | FYETGSGDYIQFHYSSVMKNLKISDSRFKQDWPKDVTRVKPRG* |
| Ga0070732_101980871 | 3300005542 | Surface Soil | EAGSGDYFLFRYTNTMKNLKIGDGKFKQDWPKNANRVKPRS* |
| Ga0068866_100373173 | 3300005718 | Miscanthus Rhizosphere | KFYESGSADYIQFHYSNVMKNLKIPDSRFKQDWPKDATRVKPGM* |
| Ga0066652_1009826482 | 3300006046 | Soil | QQKFYESGSADYIQFHYSNVMKNLKIPDSRFKQDWPKDATRVKPGI* |
| Ga0075028_1003291772 | 3300006050 | Watersheds | FEAGSGDYIQFHYSNVMKNLKISDSRFKQDWPKDASRVKPGL* |
| Ga0070716_1015669042 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | AGGDYFLVKYSNMMKNLKISDAKFKQDWPKEANRVKPRS* |
| Ga0070765_1001634793 | 3300006176 | Soil | ILFHYTNMMKNLKINESKFKQDWPKNASHEKPHA* |
| Ga0070765_1011878712 | 3300006176 | Soil | IQQKFYETGSGDYILFHYTNALEDLKINESEFKQDWPKNASHEKPHV* |
| Ga0066660_109016322 | 3300006800 | Soil | GDYFLFHYTNQMKNLKVGDGQFKPNWPKSVTRVKPRG* |
| Ga0079220_119919681 | 3300006806 | Agricultural Soil | DYIQFHYSNVMKNLKIPDSRFKPDWPKDATRVRPGM* |
| Ga0075426_106478691 | 3300006903 | Populus Rhizosphere | GSGDYFLFHYTNEMKNLKVGDKEFKQDWPKGVTRVKPRG* |
| Ga0099794_102740312 | 3300007265 | Vadose Zone Soil | AGSGDYFMFHYINAMKNLPLGDVKFKQDWPKGVTRAKPRG* |
| Ga0066710_1027757581 | 3300009012 | Grasslands Soil | QQKFFEAGSGDYFLFHYTNAMKNLKVGDGQFKQDWPKSATRVKPRG |
| Ga0105240_124539741 | 3300009093 | Corn Rhizosphere | SSWLPVQQKFYESGSADYIQFHYSNVMKNLKIPDSRFKQDWPKDATRVKPGM* |
| Ga0126380_118193441 | 3300010043 | Tropical Forest Soil | ADYIQFHYSNVMKNLKIPDSRFKQDWPKDATRVKPGL* |
| Ga0126383_135023361 | 3300010398 | Tropical Forest Soil | EAGTGDYFLFHYTNEMKNLQLGDGKFKQDWPKSVSRVKPRG* |
| Ga0150983_139389072 | 3300011120 | Forest Soil | SGDYFLFHYTNLMKNLKLDDVKFKPDWPKSVQKIKPRG* |
| Ga0137392_101385423 | 3300011269 | Vadose Zone Soil | SWLPVQQKFFEAASGDYFLFHYTNVMRNLKIGDGPFKQNWPKNVSRIKPRA* |
| Ga0137392_112282421 | 3300011269 | Vadose Zone Soil | YVLSHYTNVMKNLKINDAKFKQDWPKSVSRVKPRA* |
| Ga0137391_102993383 | 3300011270 | Vadose Zone Soil | GDYVLSHYTNVMKNLKINDAKFKQDWPKSVSRVKPRA* |
| Ga0137391_111162462 | 3300011270 | Vadose Zone Soil | EAGSGDYFLFHYTNVMKNLKISESKFKQDWPKGVSRVKPRA* |
| Ga0137389_100185176 | 3300012096 | Vadose Zone Soil | DYFLVRYSNMVKNLKINDAKFKQDWPKDANRVKPRS* |
| Ga0137364_102984332 | 3300012198 | Vadose Zone Soil | SGDYFLFHYINAMKNLKIGDGKFKQDWPKSVSRVKPHA* |
| Ga0137363_104784091 | 3300012202 | Vadose Zone Soil | GDYFLFHYINAMKNLPLGDVKFKQDWPKGVTRVKPRG* |
| Ga0137363_107106001 | 3300012202 | Vadose Zone Soil | AGSGDYVLSHYTNVMKNLKINDAKFKQDWPKSVSRVKPRA* |
| Ga0137363_117830951 | 3300012202 | Vadose Zone Soil | SWLPIQQKFFETGAGDYIQFHYSNVMKNLKIPDSRFKQDWPKDVNRVKPRG* |
| Ga0137362_117765142 | 3300012205 | Vadose Zone Soil | DYFMFHYINAMKNLPLGDVKFKQDWPKGVTRVKPRG* |
| Ga0137378_109661661 | 3300012210 | Vadose Zone Soil | DYVLSHYTNVMKNLKINDAKFKQDWPKSVSRVKPRA* |
| Ga0137378_114043841 | 3300012210 | Vadose Zone Soil | AGSGDYVLSHYTNVMKNLKISDAKFKQDWPKSVSRVKPRA* |
| Ga0137370_104085262 | 3300012285 | Vadose Zone Soil | YFLFHYINAMKNLKIGDGKFKQDWPKSVSRVKPHA* |
| Ga0137360_100881981 | 3300012361 | Vadose Zone Soil | YFLFHYINAMKNLPLGDVKFKQDWPKGVTRVKPRG* |
| Ga0137397_103364282 | 3300012685 | Vadose Zone Soil | DYFLVKYSNMMKNLKINDAKFKPDWPKNATHVKPRQ* |
| Ga0137419_113524531 | 3300012925 | Vadose Zone Soil | GGDYFLVKYSNMMKNLKINDAKFKPDWPKNATHVKPRQ* |
| Ga0137407_1000053713 | 3300012930 | Vadose Zone Soil | MYILFHYSNVMKNLKISDFRFKQDWPKDANRVKPRG* |
| Ga0137407_100297161 | 3300012930 | Vadose Zone Soil | GSGDYFLFHYTNLMKNLKLGDVKFKPDWPKSVIKIKPRG* |
| Ga0137407_100994053 | 3300012930 | Vadose Zone Soil | WLPVQQKFFEAGSGDYFLFHYINAMKNLPLGDVKFKQDWPKGVTRVKPRG* |
| Ga0153915_119556311 | 3300012931 | Freshwater Wetlands | GSGDYFIFHYTNVALNSKIANNRFKPDWPKDVTRIKPRG* |
| Ga0126369_122328841 | 3300012971 | Tropical Forest Soil | FFEAGSGDYFLFHYTNAMKNLKLGDVKFKQDWPKSVTGVEPRG* |
| Ga0182037_110537841 | 3300016404 | Soil | GSGDYFLFHYKNLMKNLKLGDVKFKPDWPKGTQKIKPHG |
| Ga0187819_106609902 | 3300017943 | Freshwater Sediment | EGGSGDYFLFHYMNAMKNLKIPDGKFKQDWPKNVTRVKPRG |
| Ga0193753_102256872 | 3300020034 | Soil | VDEASWMPIQQKFFEPAEGDYFLFHYSNVKQNLKIDESEFKQDWPKNVSRIKPQK |
| Ga0210407_100574931 | 3300020579 | Soil | LPIQQKFYETGAGDYILFHYTNMMKNLKINESEFKQNWPKNASHEKPHV |
| Ga0179596_101065312 | 3300021086 | Vadose Zone Soil | YILFHYSNVMKNLKISDFRFKQDWPKDANRVKPRG |
| Ga0210406_105875132 | 3300021168 | Soil | ETGSGDYILFHYTGMMKNLKINDSRFKQDWPKNASHEKPHG |
| Ga0210405_103209461 | 3300021171 | Soil | YILFHYTGMMKNLKINDSKFKQDWPKNASHEKPHA |
| Ga0210408_115010252 | 3300021178 | Soil | SGDYILFHYTSMMKNLKINDSRFKQDWPKNASHEKPHA |
| Ga0210396_113958442 | 3300021180 | Soil | YILFHYTNMMKNLKINESEFKQNWPKNASHEKPHV |
| Ga0210394_1000207730 | 3300021420 | Soil | ASWLPVQQKFYETGAGDYIQFHYTNMMKNLKINESKFKQDWPKNASHEKPHV |
| Ga0210398_102738402 | 3300021477 | Soil | GDYISFHYTNMMKNLKINESEFKQDWPKNASHEKPHV |
| Ga0210402_101377061 | 3300021478 | Soil | PVQQKFFEPGSGDYFLFHYTNLMKNLKLGDVKFKPDWPKSVSKIKPRG |
| Ga0210402_114364472 | 3300021478 | Soil | SWLPIEQKFYEAGSGDYLLFHYTKTMKNLKINGSKFKQDWPKGVSHVKPRG |
| Ga0210402_118487591 | 3300021478 | Soil | FETGSGDYVLFHYTSMMKNLKIGDDKFKQDWPKGATHVKPHA |
| Ga0210410_102358561 | 3300021479 | Soil | QQKFYEAAAGDYFLFHYSDIKKNLKINDSKFKQDWPKDVNRVKPRA |
| Ga0210410_109548062 | 3300021479 | Soil | QQKIFESGSGDYILFHYTSMMKNLKINDSRFKQDWPKNASHEKPHA |
| Ga0210409_109415591 | 3300021559 | Soil | SWLPVQQKFYETGAGDYIQFHYTNMMKNLKINESKFKQDWPKNASHEKPHV |
| Ga0242671_10714731 | 3300022714 | Soil | WLPIQQKIFESGSGDYILFHYTSMMKNLKINDSKFKQDWPKNASHEKPHA |
| Ga0207692_108791602 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | KFFETGAGDYIQFHYTNVMKNLKINDSRFKQDWPKDVNRVKPRG |
| Ga0207699_111315332 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | KFYESGSADYIQFHYSNVMKNLKIPDSRFKQDWPKDATRVKPGI |
| Ga0207663_106952812 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | IDEASWLPIQQKFLESGSEDYLIFHYTNVMKNLKIGDNQFKQDWPKSVIRTKPRS |
| Ga0207658_106978641 | 3300025986 | Switchgrass Rhizosphere | SWLPVQQKFYESGSADYIQFHYSNVMKNLKIPDSRFKQDWPKDATRVKPGM |
| Ga0207703_112885482 | 3300026035 | Switchgrass Rhizosphere | QKFYESGSADYIQFHYSNVMKNLKIPDSRFKQDWPKDATRVKPGM |
| Ga0209238_10694091 | 3300026301 | Grasslands Soil | FFEAGSGDYFLFHYINAMKNLKIGDAKFKQDWPKSVSRVKPHA |
| Ga0209761_10324934 | 3300026313 | Grasslands Soil | GSGDYFLFHYTNIVKNAQLPDSRFKQDWPKGATRVKPRF |
| Ga0257161_11118582 | 3300026508 | Soil | GDYIQFHYLSVMKNLKINDSRFKQDWPKDANRVKPRG |
| Ga0179593_10234851 | 3300026555 | Vadose Zone Soil | AKFFEAGSGDYFLFHYINAMKNLPLGDVKFKQDWPKGVTRVKPRG |
| Ga0179587_106486182 | 3300026557 | Vadose Zone Soil | DYFLVKYSNMMKNLKISDAKFKQDWPKDANRVKPRS |
| Ga0209588_12508252 | 3300027671 | Vadose Zone Soil | GSGDYFMFHYINAMKNLPLGDVKFKQDWPKGVTRVKPRG |
| Ga0209448_102248672 | 3300027783 | Bog Forest Soil | LPVQQKFFEAGSGDYILFHYTNLMKNLKISESRFKQDWPKDATHEKPHG |
| Ga0209180_102207502 | 3300027846 | Vadose Zone Soil | EAASGDYFLFHYTNVMRNLKIGDGPFKQNWPKNVSRIKPRA |
| Ga0209274_107147511 | 3300027853 | Soil | SGSGDYILFHYTSLMKNLKINDSKFKQDWPKNASHEKPHA |
| Ga0209701_103643542 | 3300027862 | Vadose Zone Soil | FYEAGSGDYFVFHYRNLMKNLKIGEPKFKQDWPKGVNRIKPRG |
| Ga0209283_100712851 | 3300027875 | Vadose Zone Soil | KFLEASGGDYFLVRYSNMVKNLKINDAKFKQDWPKDANRVKPRS |
| Ga0209275_105415692 | 3300027884 | Soil | FFDTGSGDYIQFHYTNMMKNLKIPDSRFKQDWPKDISHVRPG |
| Ga0209488_106230761 | 3300027903 | Vadose Zone Soil | KFYEAGSGDYFLFHYTNVMKNLKINESKFKQDWPKGVSRVKPHA |
| Ga0209583_100184093 | 3300027910 | Watersheds | AAWLPIQLKFYEAGSGDYLILHYTNLLKNLKIGEPKFKQDWPKGVSRIRPRG |
| Ga0222749_107263061 | 3300029636 | Soil | QKFHETGSGDYIQFHYSNVMKNLKISDSRFKKDWPKDVTRVKPRG |
| Ga0265753_10365221 | 3300030862 | Soil | KFYETGSGDYILFHYTNALEDLKINESEFKQDWPKNASHEKPHV |
| Ga0170834_1116621681 | 3300031057 | Forest Soil | SWLPIQQKFFESGSEDYLIFHYTKVMKNLKIGDNQFKQDWPKGVTRTKPRS |
| Ga0170824_1035156471 | 3300031231 | Forest Soil | DYLIFHYTKVMKNLKIGDNQFKQDWPKGVTRTKPRS |
| Ga0170824_1256125052 | 3300031231 | Forest Soil | SWLPIQQKFFETGAGDYIQFHYTNVMKNLKINDSRFKQDWPKDVNRVKPRG |
| Ga0302325_102664124 | 3300031234 | Palsa | FEATEGDYIQFHYQDLKKNLKLNDNKFKQDWPKNVTRVKP |
| Ga0170820_132010781 | 3300031446 | Forest Soil | VFFFFEAGAEDYLIFHYTHVMKNLKIDDGRFKQDWPKGASRTKPRA |
| Ga0307476_103470361 | 3300031715 | Hardwood Forest Soil | GTGDYFQFHYLNELKNLKIPDAKFKQDWPKGASRVKPHA |
| Ga0307477_110562291 | 3300031753 | Hardwood Forest Soil | DYFQFHYLNELKNLKIPDAKFKQDWPKGASRVKPHA |
| Ga0307475_114730441 | 3300031754 | Hardwood Forest Soil | LKFYEAGSGDYLILHYTNLMKNLNIGDAKFKQDWPKGVTRVKPRG |
| Ga0318565_101191052 | 3300031799 | Soil | YFLFHYTNEMKNLKVSDSQFKQDWPKGVTRVKPSG |
| Ga0307473_111278212 | 3300031820 | Hardwood Forest Soil | GSGDYLILHYTNLMKNLKIGEPKFKQDWPKGVSRIKPRG |
| Ga0307479_106283951 | 3300031962 | Hardwood Forest Soil | GSGDYFLFHYTNVIKNLKIGDAKFKQDWPKSVSHVKPRG |
| Ga0307479_118432362 | 3300031962 | Hardwood Forest Soil | TGSGDYIQFHYANVMKNLKIADSRFKQDWPKDVNRVKPRG |
| Ga0307471_1028966142 | 3300032180 | Hardwood Forest Soil | SWLPAQQKFYESGSADYIQFHYSNVMKNLKIPDSRFKQDWPKDATRVKPGI |
| Ga0307472_1005217822 | 3300032205 | Hardwood Forest Soil | PIQLKFYEAGSGDYLILHYKNLMKNLKIGEPKFKQDWPKGVSRIKPRG |
| ⦗Top⦘ |