| Basic Information | |
|---|---|
| Family ID | F105670 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 148 residues |
| Representative Sequence | SDGKYVFEKRDEQTVGKPKVKTAEGTLGADDLQHLKTILDDENLKKVVTPKPPDIPNNATIREIESVDAQIDHAGTMQRLTTIKERLKMGASEFGGATNGMDTYLDNAAPFQKTLNPLMKWFDGVEKKSKSDFKDSKPQYCAPMNIG |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 6.06 % |
| % of genes near scaffold ends (potentially truncated) | 31.00 % |
| % of genes from short scaffolds (< 2000 bps) | 27.00 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|