


| Basic Information | |
|---|---|
| Family ID | F105660 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 44 residues |
| Representative Sequence | STFFGVPVHFISLDDLVANKQALGRSSDLKDLKQNPKRAKS |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.00 % |
| % of genes from short scaffolds (< 2000 bps) | 81.00 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (17.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.88% β-sheet: 5.80% Coil/Unstructured: 62.32% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF04098 | Rad52_Rad22 | 8.00 |
| PF00436 | SSB | 5.00 |
| PF00196 | GerE | 4.00 |
| PF01850 | PIN | 4.00 |
| PF07311 | Dodecin | 4.00 |
| PF02604 | PhdYeFM_antitox | 3.00 |
| PF01725 | Ham1p_like | 3.00 |
| PF08843 | AbiEii | 2.00 |
| PF02927 | CelD_N | 2.00 |
| PF01402 | RHH_1 | 1.00 |
| PF07992 | Pyr_redox_2 | 1.00 |
| PF02954 | HTH_8 | 1.00 |
| PF01381 | HTH_3 | 1.00 |
| PF04216 | FdhE | 1.00 |
| PF12969 | DUF3857 | 1.00 |
| PF00999 | Na_H_Exchanger | 1.00 |
| PF00881 | Nitroreductase | 1.00 |
| PF13340 | DUF4096 | 1.00 |
| PF07690 | MFS_1 | 1.00 |
| PF03400 | DDE_Tnp_IS1 | 1.00 |
| PF02899 | Phage_int_SAM_1 | 1.00 |
| PF08897 | DUF1841 | 1.00 |
| PF13470 | PIN_3 | 1.00 |
| PF00582 | Usp | 1.00 |
| PF01127 | Sdh_cyt | 1.00 |
| PF00293 | NUDIX | 1.00 |
| PF00578 | AhpC-TSA | 1.00 |
| PF09721 | Exosortase_EpsH | 1.00 |
| PF07681 | DoxX | 1.00 |
| PF09933 | DUF2165 | 1.00 |
| PF00156 | Pribosyltran | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 5.00 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 5.00 |
| COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 4.00 |
| COG0127 | Inosine/xanthosine triphosphate pyrophosphatase, all-alpha NTP-PPase family | Nucleotide transport and metabolism [F] | 3.00 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 3.00 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 3.00 |
| COG2253 | Predicted nucleotidyltransferase component of viral defense system | Defense mechanisms [V] | 2.00 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 1.00 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 1.00 |
| COG1662 | Transposase and inactivated derivatives, IS1 family | Mobilome: prophages, transposons [X] | 1.00 |
| COG2009 | Succinate dehydrogenase/fumarate reductase, cytochrome b subunit | Energy production and conversion [C] | 1.00 |
| COG2142 | Succinate dehydrogenase, hydrophobic anchor subunit | Energy production and conversion [C] | 1.00 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 1.00 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 1.00 |
| COG3058 | Formate dehydrogenase maturation protein FdhE | Posttranslational modification, protein turnover, chaperones [O] | 1.00 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 1.00 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 1.00 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 1.00 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 1.00 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.00 % |
| Unclassified | root | N/A | 1.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004080|Ga0062385_10100154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1400 | Open in IMG/M |
| 3300004114|Ga0062593_100117021 | All Organisms → cellular organisms → Bacteria | 1930 | Open in IMG/M |
| 3300004635|Ga0062388_100305911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1329 | Open in IMG/M |
| 3300005187|Ga0066675_10756316 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 732 | Open in IMG/M |
| 3300005436|Ga0070713_101145393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 752 | Open in IMG/M |
| 3300005451|Ga0066681_10378511 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300006047|Ga0075024_100613807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300006057|Ga0075026_100762605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300006162|Ga0075030_100592709 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 879 | Open in IMG/M |
| 3300006175|Ga0070712_100005116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 8118 | Open in IMG/M |
| 3300006176|Ga0070765_101543323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
| 3300006800|Ga0066660_11317740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300009088|Ga0099830_10104870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2116 | Open in IMG/M |
| 3300009176|Ga0105242_10882060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 893 | Open in IMG/M |
| 3300009552|Ga0116138_1098116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 814 | Open in IMG/M |
| 3300009700|Ga0116217_10203791 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1299 | Open in IMG/M |
| 3300009700|Ga0116217_10891662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300009839|Ga0116223_10468828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
| 3300010343|Ga0074044_10333161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 996 | Open in IMG/M |
| 3300010358|Ga0126370_12254468 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300010376|Ga0126381_104881245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300010379|Ga0136449_101123569 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1248 | Open in IMG/M |
| 3300011120|Ga0150983_15845301 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300011269|Ga0137392_10876809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → unclassified Terriglobus → Terriglobus sp. TAA 43 | 739 | Open in IMG/M |
| 3300011269|Ga0137392_10916363 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300012203|Ga0137399_11692635 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300012210|Ga0137378_11510354 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300012351|Ga0137386_10944273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300012363|Ga0137390_10354429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1448 | Open in IMG/M |
| 3300012683|Ga0137398_10018355 | All Organisms → cellular organisms → Bacteria | 3744 | Open in IMG/M |
| 3300012683|Ga0137398_10283792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1110 | Open in IMG/M |
| 3300012918|Ga0137396_10407539 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1008 | Open in IMG/M |
| 3300012918|Ga0137396_10723111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
| 3300012925|Ga0137419_10008349 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae → Candidatus Jettenia → Candidatus Jettenia caeni | 5424 | Open in IMG/M |
| 3300012925|Ga0137419_10420805 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1047 | Open in IMG/M |
| 3300012925|Ga0137419_11520447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300012944|Ga0137410_10741079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 821 | Open in IMG/M |
| 3300014490|Ga0182010_10816423 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300014491|Ga0182014_10625394 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300015241|Ga0137418_10141915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2123 | Open in IMG/M |
| 3300015241|Ga0137418_10918447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300015374|Ga0132255_101726031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 950 | Open in IMG/M |
| 3300017935|Ga0187848_10208933 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300017943|Ga0187819_10037084 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2882 | Open in IMG/M |
| 3300017943|Ga0187819_10819264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300017961|Ga0187778_10483825 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 820 | Open in IMG/M |
| 3300017972|Ga0187781_10373931 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → unclassified Opitutus → Opitutus sp. GAS368 | 1016 | Open in IMG/M |
| 3300017975|Ga0187782_10048324 | All Organisms → cellular organisms → Bacteria | 3098 | Open in IMG/M |
| 3300018006|Ga0187804_10595775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300018017|Ga0187872_10334491 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300018040|Ga0187862_10697932 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 593 | Open in IMG/M |
| 3300018085|Ga0187772_10438390 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300018086|Ga0187769_10787617 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 719 | Open in IMG/M |
| 3300018468|Ga0066662_12569927 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300019278|Ga0187800_1069966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia grimesii | 570 | Open in IMG/M |
| 3300021046|Ga0215015_10896783 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
| 3300021180|Ga0210396_10511288 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1050 | Open in IMG/M |
| 3300021407|Ga0210383_11782469 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300021433|Ga0210391_11052764 | Not Available | 633 | Open in IMG/M |
| 3300021477|Ga0210398_10347709 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300021477|Ga0210398_10624822 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 874 | Open in IMG/M |
| 3300021479|Ga0210410_11345203 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300023250|Ga0224544_1035810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 702 | Open in IMG/M |
| 3300025500|Ga0208686_1026964 | All Organisms → cellular organisms → Bacteria | 1449 | Open in IMG/M |
| 3300026325|Ga0209152_10354142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300026467|Ga0257154_1008216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1401 | Open in IMG/M |
| 3300026551|Ga0209648_10063471 | All Organisms → cellular organisms → Bacteria | 3127 | Open in IMG/M |
| 3300027667|Ga0209009_1095860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 753 | Open in IMG/M |
| 3300027911|Ga0209698_10074231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2899 | Open in IMG/M |
| 3300027911|Ga0209698_10523431 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300028780|Ga0302225_10041273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2297 | Open in IMG/M |
| 3300028882|Ga0302154_10283777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 818 | Open in IMG/M |
| 3300028906|Ga0308309_10077102 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2507 | Open in IMG/M |
| 3300029883|Ga0311327_10207556 | All Organisms → cellular organisms → Bacteria | 1334 | Open in IMG/M |
| 3300029922|Ga0311363_10537907 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300029945|Ga0311330_10832229 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300030007|Ga0311338_10014312 | All Organisms → cellular organisms → Bacteria | 11685 | Open in IMG/M |
| 3300030007|Ga0311338_10169720 | All Organisms → cellular organisms → Bacteria | 2563 | Open in IMG/M |
| 3300030042|Ga0302300_1120497 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300030580|Ga0311355_11353161 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 621 | Open in IMG/M |
| 3300030991|Ga0073994_12327752 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300031524|Ga0302320_10947364 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 923 | Open in IMG/M |
| 3300031545|Ga0318541_10067153 | All Organisms → cellular organisms → Bacteria | 1873 | Open in IMG/M |
| 3300031561|Ga0318528_10687576 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300031680|Ga0318574_10734130 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300031708|Ga0310686_108562348 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300031708|Ga0310686_114336784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1014 | Open in IMG/M |
| 3300031715|Ga0307476_10006518 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7094 | Open in IMG/M |
| 3300031718|Ga0307474_11201989 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300031823|Ga0307478_10669788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 869 | Open in IMG/M |
| 3300031835|Ga0318517_10321829 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
| 3300031879|Ga0306919_10025911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3628 | Open in IMG/M |
| 3300032770|Ga0335085_11439585 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300032892|Ga0335081_10134377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3578 | Open in IMG/M |
| 3300032892|Ga0335081_10405405 | All Organisms → cellular organisms → Bacteria | 1752 | Open in IMG/M |
| 3300032955|Ga0335076_11725797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300033402|Ga0326728_10005441 | All Organisms → cellular organisms → Bacteria | 35723 | Open in IMG/M |
| 3300033402|Ga0326728_10021759 | All Organisms → cellular organisms → Bacteria | 12003 | Open in IMG/M |
| 3300033405|Ga0326727_10034078 | All Organisms → cellular organisms → Bacteria | 8845 | Open in IMG/M |
| 3300034090|Ga0326723_0349691 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.00% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.00% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.00% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 4.00% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 4.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.00% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.00% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.00% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.00% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.00% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.00% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.00% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300023250 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14 | Environmental | Open in IMG/M |
| 3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028882 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030042 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062385_101001542 | 3300004080 | Bog Forest Soil | VASTFFGVPVHFISLDDLLTNKRALGRESDLTDLKQNSNAKKPQE* |
| Ga0062593_1001170211 | 3300004114 | Soil | RRVAGTFFGVPVHFISLDHLLANKGALGRSSDLKDLRQKLKSPETEG* |
| Ga0062388_1003059112 | 3300004635 | Bog Forest Soil | AWGKRVASTFFGVPVHFISLDDLLTNKRALGRDSDLTDLKQNSNAKKPQE* |
| Ga0066675_107563161 | 3300005187 | Soil | EFSNAWKKRVASTFFGVPVHFISLDDLTTNKQALGRSSDLKDLKQNPARGKPQK* |
| Ga0070713_1011453931 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | TFFGAPVNFISLDDLSINKRALGRSSDLKDLKQVTDRSKSNQ* |
| Ga0066681_103785112 | 3300005451 | Soil | GVPVHFISLDDLSTNKRALGRSSDLTDLQKSPDRGKPKK* |
| Ga0075024_1006138071 | 3300006047 | Watersheds | FFGVAVNFISLDDLVANKQALGRSSDLKDLKQNPKSTDSKK* |
| Ga0075026_1007626051 | 3300006057 | Watersheds | RKRVASTFFGVPVHFISLDDLVTNKQALGRSSDLKDLKQNPKSTDSKK* |
| Ga0075030_1005927091 | 3300006162 | Watersheds | HFISLDDLVANKKALGRSSDLKDLTRNPKGTNSKK* |
| Ga0070712_1000051161 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | HFISLDDLLANKRALGRDSDLKDIKQNSKSRNSEE* |
| Ga0070765_1015433231 | 3300006176 | Soil | VHFISLDDLLTNKRALGRDSDLTDLKRNANAAKPEK* |
| Ga0066660_113177402 | 3300006800 | Soil | FISLDDLVANKQALGRSSDLKDLKQNPKGAKSEE* |
| Ga0099830_101048706 | 3300009088 | Vadose Zone Soil | FISLDDLVTNKQALGRSSDLKDLKQNPKSTPLDE* |
| Ga0105242_108820601 | 3300009176 | Miscanthus Rhizosphere | KRVASTFFGVPVHFISLDDLMANKQALGRGSDLKDLKQNPKSRNSEK* |
| Ga0116138_10981162 | 3300009552 | Peatland | ASTFFGVPVHFISLDDLVANKRALGRSSDLKDLKQNPKRAKS* |
| Ga0116217_102037911 | 3300009700 | Peatlands Soil | GVPVHFISLDDLVTNKQALGRSGDLKDLKQSPKSAKSDKLR* |
| Ga0116217_108916622 | 3300009700 | Peatlands Soil | FGVPVNFISMDDLATNKQALGRSSDLKDLKQNPKSTHSDK* |
| Ga0116223_104688281 | 3300009839 | Peatlands Soil | VASTFFGVPVHFISLDDLMANKQALGRAIDVRDLKHNPKSEKPEK* |
| Ga0074044_103331611 | 3300010343 | Bog Forest Soil | PVHFISLDDLVANKQALGRSSDLKDLKQNPKGEKP* |
| Ga0126370_122544681 | 3300010358 | Tropical Forest Soil | PEGWRKRVAGTFFGVAVHFISLDDLVGNKQALGRSGDLEDLKRNPGTSTPKT* |
| Ga0126381_1048812451 | 3300010376 | Tropical Forest Soil | HFISFDDLVANKKALGRSSDLKDLMRNSERANAEDE* |
| Ga0136449_1011235691 | 3300010379 | Peatlands Soil | VEFSDAWQKKVASSFFGVPVHFISLDDLLTNKRALGRDSDLTDLKRNSNATKPEK* |
| Ga0150983_158453011 | 3300011120 | Forest Soil | KKVSSSFFGVPVHFISMDDLLTNKRALGRDSDLKDLKRSSNAAKPEK* |
| Ga0137392_108768091 | 3300011269 | Vadose Zone Soil | VNFISLDDLVTNKQALGRSSDLKDLKQRPRKTHSDK* |
| Ga0137392_109163631 | 3300011269 | Vadose Zone Soil | LSESDLIRERVSASTFFGVPVHFISLDDLRTNKKALGRSSDLKDLKNDPKSPNS* |
| Ga0137399_116926351 | 3300012203 | Vadose Zone Soil | ASSFFGVPVHFISLDDLLTNKRALGRDRDLTDLKRDSNAAKPEK* |
| Ga0137378_115103541 | 3300012210 | Vadose Zone Soil | VHFISLDDLVANKQALGRSSDLKDLKQNPKRAKS* |
| Ga0137386_109442731 | 3300012351 | Vadose Zone Soil | FIALDDLVTNKQALGRSSDLKDLKRNRKSTDSQE* |
| Ga0137390_103544291 | 3300012363 | Vadose Zone Soil | WRKRVASTFFGVPVHFISLEDLAANKQALGRSSDLKDLKQNPKSADSEK* |
| Ga0137398_100183557 | 3300012683 | Vadose Zone Soil | VHFISIDDLIANKRALGRDSDLKDLKQNPKSRNSEK* |
| Ga0137398_102837921 | 3300012683 | Vadose Zone Soil | VASSFFGVPVHFISLDDLLTNKRALGRGSDLTDLKQSPDSAKAKK* |
| Ga0137396_104075392 | 3300012918 | Vadose Zone Soil | NFISLDDLVANKQALGRSSDLKDLKQNPKSTDSKK* |
| Ga0137396_107231112 | 3300012918 | Vadose Zone Soil | AVEFSDAWSKRVASSFFGVPVHFISLDDLSANKRALGRTGDLTDLKQSPKSAEPEK* |
| Ga0137419_100083498 | 3300012925 | Vadose Zone Soil | KRVASTFFGVPVNFISLDDLVTNKQALGRSSDVKDLKQNPKRTHLDK* |
| Ga0137419_104208051 | 3300012925 | Vadose Zone Soil | KRVASTFFGVPVNFISLDDLVTNKQALGRSGDLKDLMQNPKHARLDE* |
| Ga0137419_115204472 | 3300012925 | Vadose Zone Soil | FFGVPVHFISLDDLVANKQALGRSSDLKDLKQNPKRAKS* |
| Ga0137410_107410791 | 3300012944 | Vadose Zone Soil | RVASTFFGVPVNFISLDDLVTNKQALGRSSDVKDLKQNPKRTHLDK* |
| Ga0182010_108164231 | 3300014490 | Fen | KVASSFFGVPVHFISLDDLLTNKRALGRDSDLIDLKRNSNAAKPDK* |
| Ga0182014_106253941 | 3300014491 | Bog | STFFGVPVHFISLDDLVANKQALGRSSDLKDLKQNPKRAKS* |
| Ga0137418_101419153 | 3300015241 | Vadose Zone Soil | SSFFGVPVHFISLDDLLTNKRALGRDSDLTDLKRNSNAAKPEK* |
| Ga0137418_109184471 | 3300015241 | Vadose Zone Soil | KRVASTFFGVPVHFISLDDLVANKQALGRSSDLKDLKQNPKRAKS* |
| Ga0132255_1017260311 | 3300015374 | Arabidopsis Rhizosphere | VSSTFFGVPVNFISLDDLVTNKRALGRSSDLKDLKQN |
| Ga0187848_102089331 | 3300017935 | Peatland | GVRFSAAWRQRVASTFFGIPVHFIAFDDLVANKQALGRNSDLADLKRNPGTSKSET |
| Ga0187819_100370843 | 3300017943 | Freshwater Sediment | GVEFRDAWRKRVASTFFGVPVHFISLDDLVANKKALGRSSDLKDLTRNPKGTNSEK |
| Ga0187819_108192641 | 3300017943 | Freshwater Sediment | PVHFISLDDLVANKQALGRSSDLTDLKQNPKSTHLDE |
| Ga0187778_104838252 | 3300017961 | Tropical Peatland | ENRVPSTFFGVPVHFISRGDLEANKRALGRASDVKDLKRNPKKSNK |
| Ga0187781_103739313 | 3300017972 | Tropical Peatland | STFFGVPVNFISLDDLVTNKRALGRDIDLKDLQQKPKSPMR |
| Ga0187782_100483241 | 3300017975 | Tropical Peatland | AWSRKVASVLFGVPVHFISLDDLVTNKEAMGRSSDLKDLRRNPKNAS |
| Ga0187804_105957751 | 3300018006 | Freshwater Sediment | TGVEFADAWKNRVSSTFFGVPVHFISQGDLEANKRALGRASDLEDLKGKNF |
| Ga0187872_103344913 | 3300018017 | Peatland | VPVHFISLDDLVANKHALGRSSDLKDLTQNPKGATSEK |
| Ga0187862_106979322 | 3300018040 | Peatland | GVPVHFISIDDLVKNKQALGRSSDLKDLKRNPKSKHLDK |
| Ga0187772_104383903 | 3300018085 | Tropical Peatland | WRKRVASTFFGVPVHFISRDDLVANKQALGRSSDLKQNPKG |
| Ga0187769_107876172 | 3300018086 | Tropical Peatland | TFFGVPVNFISLDDLVTNKRALGRDSDLKDLRQEPKSPKH |
| Ga0066662_125699271 | 3300018468 | Grasslands Soil | PVNFISLDDLVTNKQALGRSSDLKDLKQNPKSTGSRK |
| Ga0187800_10699661 | 3300019278 | Peatland | GVDFAQAWGRRVSGTFFGVPVNFISPDDLVINKTALGRASDLKDLARKPKE |
| Ga0215015_108967832 | 3300021046 | Soil | VHFISLDDLVANKQALGRSSDLKDLKQNPKRVNSDN |
| Ga0210396_105112881 | 3300021180 | Soil | RFFGVPVHFISLDDLLTNKRALGRDSDLSDLKRNSNAAKPEK |
| Ga0210383_117824691 | 3300021407 | Soil | TFFGVPVNFISLDDLVTNKQALGRSTDLKDLKQNPKSPHSDK |
| Ga0210391_110527642 | 3300021433 | Soil | SFFGVPVHFISLDDLLTNKRALGRDSDLTDLKRNSNAAKPEK |
| Ga0210398_103477091 | 3300021477 | Soil | TAVEFSDAWQKKVASSFFGVPVHFISLDDLLTNKRALGRDSDLTDLKRNSNPATPEK |
| Ga0210398_106248221 | 3300021477 | Soil | GVPVNFISLDDLVANKQALGRSSDLKDLKQNRKSTDSKK |
| Ga0210410_113452031 | 3300021479 | Soil | TFFGVPVHFISLEDLRANKKALGRASDLKDLNQNPKIRNSEM |
| Ga0224544_10358102 | 3300023250 | Soil | STFFGVPVNFISLDDLIVNKQAIGRSSDLKDLKQNRKSPKSEE |
| Ga0208686_10269641 | 3300025500 | Peatland | TGVRFSAAWRQRVASTFFGIPVHFIAFDDLVANKQALGRNSDLADLKRNPGTSKSET |
| Ga0209152_103541421 | 3300026325 | Soil | DAWRKRVASTFFGVPVHFISLDDLVANKQALGRTSDLKDLKQHPKNAKSEK |
| Ga0257154_10082161 | 3300026467 | Soil | KVAGSFFGVLVHFISLDDLLTNKRALGRDSDLTDLKRNSNAAKPEK |
| Ga0209648_100634718 | 3300026551 | Grasslands Soil | KRVASTFFGVPVHFISLDDLVANKQALGRSTDLKDLKQNPKSTHLDT |
| Ga0209009_10958602 | 3300027667 | Forest Soil | MRGKRVASTFFGVPVHFISLDDLVANKQALGRSSDLKDLKQNPKRMKSDR |
| Ga0209698_100742315 | 3300027911 | Watersheds | WQKKVASSFFGVPVHFISLDDLLINQRALGRDSDLTDLKRNSNAAKPEK |
| Ga0209698_105234313 | 3300027911 | Watersheds | MSSPATEITGVEFADAWTKRVESTFFGVPVHFISLDDLRANKQALGRSSDL |
| Ga0302225_100412735 | 3300028780 | Palsa | STFFGVPVHFISLDDLVANKQALGRSSDLKDLKQNPKRAKS |
| Ga0302154_102837771 | 3300028882 | Bog | VPVHFISLDDLVANKQALGRSSDLKDLKQNPKRAKS |
| Ga0308309_100771025 | 3300028906 | Soil | VHFISLDDLVTNKQALGRSSDVKDLKQNPKSTHLEK |
| Ga0311327_102075563 | 3300029883 | Bog | KRVASTFFGVPVHFISLDDLVANKQALGRSSDLKDLKQNPKRAKS |
| Ga0311363_105379073 | 3300029922 | Fen | FFGVPVHFISLDDLVANKQALGRSSDLKDLKQNPKRAKS |
| Ga0311330_108322291 | 3300029945 | Bog | ASTFFGVPVHFISLDDLVANKQALGRSSDLKDLKQNPKRAKS |
| Ga0311338_100143121 | 3300030007 | Palsa | RVASTFFGVPVHFISLDDLVANQQALGRSSDLKDLKQNPKRAKS |
| Ga0311338_101697205 | 3300030007 | Palsa | FSAAWRQRVASTFFGIPVHFIAFDDLVANKQALGRNSDLADLKRNPGTSKSET |
| Ga0302300_11204972 | 3300030042 | Palsa | EFTDAWGKRVASTFFGVPVHFISLDDLVANKQALGRSSDLKDLKQNPKRAKS |
| Ga0311355_113531612 | 3300030580 | Palsa | STFFGIPVHFIAFDDLVANKQALGRNSDLADLKRNPGTSKSET |
| Ga0073994_123277521 | 3300030991 | Soil | VEFPDAWGKRVASTFFGVPVHFISLDDLVANKQALGRSSDLEDLKQNPKRVNSDN |
| Ga0302320_109473643 | 3300031524 | Bog | PVHFISLDDLVANKQALGRSSDLKDLKQNPKRAKS |
| Ga0318541_100671534 | 3300031545 | Soil | VTVYFISFDDLVTKKQALGRSSDLKDLKQNPNRPKA |
| Ga0318528_106875762 | 3300031561 | Soil | LFAVTVYFISFDDLVTKKQALGRSSDLKDLKQNPNRPKA |
| Ga0318574_107341301 | 3300031680 | Soil | AWRNKVASTLFAVTVYFISFDDLVTKKQALGRSSDLKDLKQNPNRPKA |
| Ga0310686_1085623481 | 3300031708 | Soil | VEFSDAWQKKVASSFFGVPVHFISLDDLLTNKRALGRDSDLTDLKRNSNAAKPEK |
| Ga0310686_1143367843 | 3300031708 | Soil | SSFFGVPVHFISLDDLLTNKRALGRDSDLTDLKWNSNAAKPEK |
| Ga0307476_1000651816 | 3300031715 | Hardwood Forest Soil | EFSDAWQTKVASSFFGVPVHFISLDDLLTNKRALGRDSDLTDLKRNANAAKPEK |
| Ga0307474_112019891 | 3300031718 | Hardwood Forest Soil | EITAVEFSDAWQTKVASSFFGVPVHFISLDDLLTNKRALGRDSDLTDLKRNANAAKPEK |
| Ga0307478_106697881 | 3300031823 | Hardwood Forest Soil | ASTFFGVPVNFISLEDLGTNKRALGRDSDLKDLRQKPKSPKH |
| Ga0318517_103218291 | 3300031835 | Soil | KFAEAWRNKVASTLFAVTVYFISFDDLVTKKQALGRSSDLKDLKQNPNRPKA |
| Ga0306919_100259111 | 3300031879 | Soil | AVTVYFISFDDLVTKKQALGRSSDLKDLKQNPNRPKA |
| Ga0335085_114395851 | 3300032770 | Soil | TGVDFADAWGKRVSSTFFGVPVHFISRSDLEVNKRALGRSSDVEDLKRNPPR |
| Ga0335081_101343771 | 3300032892 | Soil | GVPVHFISLDDLTTNKQALGRSSDLKDLKQNPKGTNTD |
| Ga0335081_104054052 | 3300032892 | Soil | FGVPVHFISLDDLVANKQALGRSSDLKDLKQNPKE |
| Ga0335076_117257972 | 3300032955 | Soil | KRVASTFFGVPVHFISRDDLVANKLALGRSSDLRDLGQSPGSGRKEG |
| Ga0326728_100054411 | 3300033402 | Peat Soil | VASSFFSVPVNFISLDDLATNKQALGRSSDLKDLKQNPKSTHSDK |
| Ga0326728_1002175913 | 3300033402 | Peat Soil | VASSFFSVPVNFISLDDLATNKQALGRSSDLKDLKQNPKSTHLDE |
| Ga0326727_1003407813 | 3300033405 | Peat Soil | SVPVNFISLDDLATNKQALGRSSDLKDLKQNPKSTHSDK |
| Ga0326723_0349691_507_665 | 3300034090 | Peat Soil | ADAWTKRVESTFFGVPVHFISLEDLMANKEALGRGSDLKDLKQSPKNRNSEK |
| ⦗Top⦘ |