


| Basic Information | |
|---|---|
| Family ID | F105634 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 46 residues |
| Representative Sequence | AKQRGGSLKLLNPSKFALQTLKLVRVLNLFEVFEDQQLAVASFS |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.00 % |
| % of genes from short scaffolds (< 2000 bps) | 89.00 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.00% β-sheet: 11.11% Coil/Unstructured: 63.89% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF09137 | Glucodextran_N | 8.00 |
| PF00860 | Xan_ur_permease | 7.00 |
| PF00821 | PEPCK_GTP | 6.00 |
| PF13620 | CarboxypepD_reg | 4.00 |
| PF05193 | Peptidase_M16_C | 3.00 |
| PF00962 | A_deaminase | 2.00 |
| PF08308 | PEGA | 2.00 |
| PF13581 | HATPase_c_2 | 2.00 |
| PF13419 | HAD_2 | 2.00 |
| PF01642 | MM_CoA_mutase | 1.00 |
| PF00756 | Esterase | 1.00 |
| PF00196 | GerE | 1.00 |
| PF05016 | ParE_toxin | 1.00 |
| PF08281 | Sigma70_r4_2 | 1.00 |
| PF04542 | Sigma70_r2 | 1.00 |
| PF02566 | OsmC | 1.00 |
| PF09983 | DUF2220 | 1.00 |
| PF00589 | Phage_integrase | 1.00 |
| PF00248 | Aldo_ket_red | 1.00 |
| PF01833 | TIG | 1.00 |
| PF13655 | RVT_N | 1.00 |
| PF04551 | GcpE | 1.00 |
| PF00210 | Ferritin | 1.00 |
| PF01148 | CTP_transf_1 | 1.00 |
| PF08240 | ADH_N | 1.00 |
| PF07690 | MFS_1 | 1.00 |
| PF14361 | RsbRD_N | 1.00 |
| PF10518 | TAT_signal | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 8.00 |
| COG1274 | Phosphoenolpyruvate carboxykinase, GTP-dependent | Energy production and conversion [C] | 6.00 |
| COG1816 | Adenosine/6-amino-6-deoxyfutalosine deaminase | Nucleotide transport and metabolism [F] | 2.00 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 1.00 |
| COG0821 | 4-hydroxy-3-methylbut-2-enyl diphosphate synthase IspG/GcpE | Lipid transport and metabolism [I] | 1.00 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 1.00 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.00 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 1.00 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 1.00 |
| COG1884 | Methylmalonyl-CoA mutase, N-terminal domain/subunit | Lipid transport and metabolism [I] | 1.00 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.00 % |
| Unclassified | root | N/A | 38.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_100013622 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1601 | Open in IMG/M |
| 3300002914|JGI25617J43924_10016515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2504 | Open in IMG/M |
| 3300004152|Ga0062386_101275550 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300005176|Ga0066679_10673403 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300005177|Ga0066690_10438238 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300005187|Ga0066675_10714390 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300005365|Ga0070688_101396158 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300005435|Ga0070714_100205374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1804 | Open in IMG/M |
| 3300005435|Ga0070714_102325339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300005437|Ga0070710_10335498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 997 | Open in IMG/M |
| 3300005437|Ga0070710_11135095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 575 | Open in IMG/M |
| 3300005538|Ga0070731_10040654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3118 | Open in IMG/M |
| 3300005545|Ga0070695_100920121 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300005559|Ga0066700_11148003 | Not Available | 507 | Open in IMG/M |
| 3300005576|Ga0066708_10093941 | All Organisms → cellular organisms → Bacteria | 1771 | Open in IMG/M |
| 3300005591|Ga0070761_10454435 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300005995|Ga0066790_10110328 | Not Available | 1180 | Open in IMG/M |
| 3300006175|Ga0070712_100645150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 899 | Open in IMG/M |
| 3300006796|Ga0066665_11334803 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300006796|Ga0066665_11506509 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300006797|Ga0066659_10931698 | Not Available | 726 | Open in IMG/M |
| 3300006804|Ga0079221_10817968 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300006893|Ga0073928_10593678 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300009038|Ga0099829_10726560 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300009137|Ga0066709_103345792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300009545|Ga0105237_12589934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300009665|Ga0116135_1436587 | Not Available | 535 | Open in IMG/M |
| 3300010048|Ga0126373_12519779 | Not Available | 573 | Open in IMG/M |
| 3300010048|Ga0126373_12779166 | Not Available | 546 | Open in IMG/M |
| 3300010337|Ga0134062_10487512 | Not Available | 618 | Open in IMG/M |
| 3300010337|Ga0134062_10757094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300010360|Ga0126372_11214753 | Not Available | 779 | Open in IMG/M |
| 3300010371|Ga0134125_10298794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1788 | Open in IMG/M |
| 3300010379|Ga0136449_102441852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 752 | Open in IMG/M |
| 3300011269|Ga0137392_11023443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
| 3300012203|Ga0137399_10226250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1527 | Open in IMG/M |
| 3300012918|Ga0137396_10702389 | Not Available | 746 | Open in IMG/M |
| 3300012948|Ga0126375_10784916 | Not Available | 752 | Open in IMG/M |
| 3300012948|Ga0126375_11378894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 596 | Open in IMG/M |
| 3300012957|Ga0164303_10035810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2085 | Open in IMG/M |
| 3300012964|Ga0153916_10085530 | Not Available | 2947 | Open in IMG/M |
| 3300012984|Ga0164309_10896312 | Not Available | 722 | Open in IMG/M |
| 3300014154|Ga0134075_10259951 | Not Available | 752 | Open in IMG/M |
| 3300015089|Ga0167643_1072568 | Not Available | 502 | Open in IMG/M |
| 3300015242|Ga0137412_10898767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300016319|Ga0182033_10745691 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 860 | Open in IMG/M |
| 3300016371|Ga0182034_11828644 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 535 | Open in IMG/M |
| 3300016445|Ga0182038_10583135 | Not Available | 963 | Open in IMG/M |
| 3300017924|Ga0187820_1209602 | Not Available | 611 | Open in IMG/M |
| 3300017943|Ga0187819_10005649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6905 | Open in IMG/M |
| 3300018006|Ga0187804_10415217 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300018062|Ga0187784_10713973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 802 | Open in IMG/M |
| 3300018086|Ga0187769_11390967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 531 | Open in IMG/M |
| 3300019789|Ga0137408_1024660 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2696 | Open in IMG/M |
| 3300020150|Ga0187768_1058596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 860 | Open in IMG/M |
| 3300020583|Ga0210401_11364445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300021168|Ga0210406_10265351 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_56_16 | 1405 | Open in IMG/M |
| 3300021178|Ga0210408_11106791 | Not Available | 609 | Open in IMG/M |
| 3300021403|Ga0210397_10572965 | Not Available | 861 | Open in IMG/M |
| 3300021403|Ga0210397_11243447 | Not Available | 579 | Open in IMG/M |
| 3300021407|Ga0210383_11191193 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300021560|Ga0126371_13217101 | Not Available | 552 | Open in IMG/M |
| 3300022724|Ga0242665_10036088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1245 | Open in IMG/M |
| 3300025157|Ga0209399_10099773 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
| 3300025404|Ga0208936_1001205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3148 | Open in IMG/M |
| 3300026294|Ga0209839_10267348 | Not Available | 532 | Open in IMG/M |
| 3300027080|Ga0208237_1029341 | Not Available | 831 | Open in IMG/M |
| 3300027546|Ga0208984_1037353 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300027591|Ga0209733_1038842 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300027605|Ga0209329_1020449 | Not Available | 1333 | Open in IMG/M |
| 3300027645|Ga0209117_1146021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300027645|Ga0209117_1172117 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300027748|Ga0209689_1407696 | Not Available | 520 | Open in IMG/M |
| 3300027767|Ga0209655_10221476 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300027795|Ga0209139_10117411 | Not Available | 939 | Open in IMG/M |
| 3300027842|Ga0209580_10415030 | Not Available | 671 | Open in IMG/M |
| 3300027874|Ga0209465_10448658 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300027875|Ga0209283_10167693 | All Organisms → cellular organisms → Bacteria | 1458 | Open in IMG/M |
| 3300027911|Ga0209698_10379483 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1107 | Open in IMG/M |
| 3300030057|Ga0302176_10041225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1763 | Open in IMG/M |
| 3300031028|Ga0302180_10552143 | Not Available | 559 | Open in IMG/M |
| 3300031057|Ga0170834_110731696 | Not Available | 577 | Open in IMG/M |
| 3300031233|Ga0302307_10654441 | Not Available | 528 | Open in IMG/M |
| 3300031561|Ga0318528_10539324 | Not Available | 626 | Open in IMG/M |
| 3300031708|Ga0310686_104705771 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300031718|Ga0307474_10025096 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4352 | Open in IMG/M |
| 3300031718|Ga0307474_11511885 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300031747|Ga0318502_10875351 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300031754|Ga0307475_10828414 | Not Available | 733 | Open in IMG/M |
| 3300031754|Ga0307475_11386783 | Not Available | 542 | Open in IMG/M |
| 3300031890|Ga0306925_10819080 | Not Available | 964 | Open in IMG/M |
| 3300031947|Ga0310909_11397836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300031962|Ga0307479_10433790 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
| 3300032051|Ga0318532_10198547 | Not Available | 712 | Open in IMG/M |
| 3300032180|Ga0307471_100768723 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300032205|Ga0307472_102248099 | Not Available | 551 | Open in IMG/M |
| 3300032342|Ga0315286_10654926 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.00% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.00% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.00% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 2.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.00% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.00% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.00% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 1.00% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.00% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.00% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.00% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015089 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025157 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025404 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300027080 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF009 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1000136221 | 3300000955 | Soil | KQRGGALKLVNPSKFAIQTLKLVGVLNLFEVFDNEETAVASFQ* |
| JGI25617J43924_100165151 | 3300002914 | Grasslands Soil | FLTSAKQQGGSLKLLNPSKFVVQTLKLVGLLNLFEVXTDAQDAVASFS* |
| Ga0062386_1012755502 | 3300004152 | Bog Forest Soil | SKQNGGSLKLLNPSKFTIQTLKLVRMLNLFEVFEDAQLAVASFE* |
| Ga0066679_106734032 | 3300005176 | Soil | IGILVRSLTSAKQRGGSVKLVNPSKFALQTLKLVGVVNLFEIFQDEDAAVASFA* |
| Ga0066690_104382383 | 3300005177 | Soil | TAKQNGGSFKLLNPSKFALQTLKLVRVLNLFEVFEDPEQAVASFGRPAF* |
| Ga0066671_106077661 | 3300005184 | Soil | RGGSVKLVNPTKFALQTLKLVGVVNLFEIFQDENEAVKSFA* |
| Ga0066675_107143902 | 3300005187 | Soil | ILVRSLTSAKQRGGSVKLVNPSKFALQTLKLVGVVNLFEIFQDEDAAVASFA* |
| Ga0070688_1013961581 | 3300005365 | Switchgrass Rhizosphere | RQLTMAKQRGGSLKLLKPSKFALQTLKLVRVLNLFEVFEDQQLAVASFQK* |
| Ga0070714_1002053741 | 3300005435 | Agricultural Soil | IGLLARFLASAKQQGGALKLANPSKFVLQTLKLVGLLNLFEVFSDSQAAAASF* |
| Ga0070714_1023253391 | 3300005435 | Agricultural Soil | GSLKLLNPTTFALQTLKLVRVLNLFEVLQDQEAAIKSFQ* |
| Ga0070710_103354983 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | RYLTAAKQQGGALKLLNPTKFAMQSLKMIGVLNLFEVYEDQEAALSSFK* |
| Ga0070710_111350952 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | GGSLKLLNPSKFALQTLKLVRVLSLFEVFEDQQIAVASFQ* |
| Ga0070731_100406544 | 3300005538 | Surface Soil | KLLKPSKFALQTLKMVRVLNLFEVFDDQQAAVASFQV* |
| Ga0070695_1009201212 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | SLKLLNPSKFAVQTLKMIGLLKLFDVFQDSEEAVASFQV* |
| Ga0066700_111480031 | 3300005559 | Soil | KLLNPSKFALQTLKLVRVLNLFEVFEDPEQAVASFGSPAF* |
| Ga0066708_100939411 | 3300005576 | Soil | SLTSAKQRGGSVKLVNPSKFALQTLKLVGVVNLFEIFQDEDAAVASFA* |
| Ga0070761_104544352 | 3300005591 | Soil | SGIGLLVKILTAAKQRGGSIKLLNPSKFTVQTLKMICLLDLFEIFEDQQLAAASFG* |
| Ga0066790_101103282 | 3300005995 | Soil | LLVRYYTSAKQNGGAVKLLNPSKFTIQTLKLVRMLNLFEVFEDPQVAVASFE* |
| Ga0070712_1006451502 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | RGGSLKLLSPSKFALQTLKLVRVLNLFEVFEDQQLAVVSFQ* |
| Ga0066665_113348032 | 3300006796 | Soil | LNPTTFAMQTLKLVRVLNLFEVLQDQEAAIKSFQ* |
| Ga0066665_115065091 | 3300006796 | Soil | TSAKQRGGSVKLVNPTKFALQTLKLVGVVNLFEIFQDEDAAVASFA* |
| Ga0066659_109316982 | 3300006797 | Soil | KLLNPSKFALQTLKLVRVLNLFEVFADQQLAVASFQ* |
| Ga0079221_108179681 | 3300006804 | Agricultural Soil | GIGVLMKSLASARQRGGNIKLVNPSKFAVQTLRMVGLLNLFEIFTDEDAAVASFS* |
| Ga0073928_105936781 | 3300006893 | Iron-Sulfur Acid Spring | HLTTAKQRGGSLKILNPSKFAVQTLKLVRVLNLFEVFEDQQQAVASFS* |
| Ga0099829_107265601 | 3300009038 | Vadose Zone Soil | LKLLNPSKFALQTLKLVRVLNLFEVFEDLQTAVASFS* |
| Ga0066709_1033457922 | 3300009137 | Grasslands Soil | SAKQRGGSVKLVNPSKFALQTLKLVGVVNLFEIFQDEDAAVASFA* |
| Ga0105237_125899342 | 3300009545 | Corn Rhizosphere | QRGGSLKLLRPSKFALQTLKLVRVLNLFEVFEDQQLAVASFQK* |
| Ga0116135_14365872 | 3300009665 | Peatland | GSLKLLNPSPFAIKTLKMIGLLKLFQVFEDQESAVASFS* |
| Ga0126373_125197791 | 3300010048 | Tropical Forest Soil | LTAAKQRGGALRLLNPSKFVTQTLKMIGLLNLFEVFADQQQAVESFR* |
| Ga0126373_127791661 | 3300010048 | Tropical Forest Soil | LTAAKQRGGALRLLNPSKFVTQTLKMIGLLNLFEVFADQQQAVESFH* |
| Ga0134062_104875121 | 3300010337 | Grasslands Soil | QRGGSLKLLNPSKFALQTLKLVRVLNLFEVFEDQQLAVASFQ* |
| Ga0134062_107570941 | 3300010337 | Grasslands Soil | SAKQRGGSVKLVNPTKFALQTLKLVGVVNLFEIFQDEDAAVASFA* |
| Ga0126372_112147532 | 3300010360 | Tropical Forest Soil | AKQRGGSLKLLNPSKFAMQTLKLVRVVNLFEIFEDQRLAVSSFQ* |
| Ga0134125_102987943 | 3300010371 | Terrestrial Soil | RILTAAKKAGGAIKLLNPSKFTSQTLKLVGILPLFEVYEDSEQALASFQ* |
| Ga0136449_1024418521 | 3300010379 | Peatlands Soil | QRGGSLKLLKPSKFALQTLRMIGLLGLFEVFDDQEQAVASFR* |
| Ga0137392_110234432 | 3300011269 | Vadose Zone Soil | SAKQQGGSLKLLNPSKFVVQTLKLVGLLNLFEVFTDAQDAVASFS* |
| Ga0137399_102262501 | 3300012203 | Vadose Zone Soil | GSLKLLNPSKFALQTLKLVRVLNLFEVFEDPEQAVASFGSPAF* |
| Ga0137387_111332042 | 3300012349 | Vadose Zone Soil | QRGGSLKLVGPSKMVLQTLKLVGILNLFEVHESDEAAVQSFG* |
| Ga0137396_107023892 | 3300012918 | Vadose Zone Soil | ARLLTAAKQRGGVLKLLKPSKFALQTLKMIGLLNLFEVFDDQQLALASFG* |
| Ga0126375_107849161 | 3300012948 | Tropical Forest Soil | SAKQQGGSVKLLNPSKFATQTLKLVGILSLFETFEDQQTAITSFD* |
| Ga0126375_113788941 | 3300012948 | Tropical Forest Soil | KLLKPSKFAVQTLKLVRVLNLFEVFEDPQLAVESFAN* |
| Ga0164303_100358103 | 3300012957 | Soil | VAKQRGGSLKLLNPSKFALQTLKLVRVLSLFEVFEDQQTGVASFQ* |
| Ga0153916_100855301 | 3300012964 | Freshwater Wetlands | IGLLVRALTSMKQRGGSIKLLKPSKFVLQTLKLVSLVKLFEIFDDLPQAVASFR* |
| Ga0164309_108963122 | 3300012984 | Soil | YLTVAKQRGGSLKLLNPSKFALQTLKLVRVLSLFEVFEDQQTGVASFQ* |
| Ga0134075_102599511 | 3300014154 | Grasslands Soil | LVRYLTAAKQRGGSLKLLNPSKFALQTLKLVRVLNLFEVFEGQQLAVASFQ* |
| Ga0157379_107248302 | 3300014968 | Switchgrass Rhizosphere | CGGAVKLVKPSKMVAQTLKMVAVLNLFEVFENEEDAVKSFS* |
| Ga0167643_10725681 | 3300015089 | Glacier Forefield Soil | VKLLNPSKFTIQTLKLVRMLNLFEVFEDQQAALASFE* |
| Ga0137412_108987672 | 3300015242 | Vadose Zone Soil | GLLVRYLTAAKQRGGSLKLLNPSKFALQTLKLVRVLNLFEVFEDQQLAVASFQ* |
| Ga0182033_107456911 | 3300016319 | Soil | GSLKLLNPSKFATQTFKMIGLLNLFEIFTDQDLAVDSFQ |
| Ga0182034_118286441 | 3300016371 | Soil | QGGSLKLLNPSKFATQTFKMIGLLNLFEIFTDQDLAVDSFQ |
| Ga0182038_105831352 | 3300016445 | Soil | SLKLLKPSKFALQTLKVVRVLNLFEVFEEQQAAVESFQH |
| Ga0187820_12096021 | 3300017924 | Freshwater Sediment | SLKLLNPSAFATKTLRMIGLLKLFEVFDDPDAAVASFNQ |
| Ga0187819_100056491 | 3300017943 | Freshwater Sediment | TAAKQRGGAVKLLNPSKFTVQTLKMIGLLPLFEVFQNQDEAVSSFN |
| Ga0187804_104152171 | 3300018006 | Freshwater Sediment | AAKQRGGAVKLLNPSKFTVQTLKMIGLLPLFEVFQNQDEAVSSFN |
| Ga0187784_107139731 | 3300018062 | Tropical Peatland | SGSLKLLNPSKFALQTLRMTGLLSLFETFEDQEQAVASFQ |
| Ga0187769_113909672 | 3300018086 | Tropical Peatland | SLTTAKQKGGNLKLVNPSKLAMQTLKIVGLVNLFEIFNDEGEAAQSFS |
| Ga0137408_10246602 | 3300019789 | Vadose Zone Soil | GLLVRYLTAAKQRGGSLKLLNPSKFALQTLKLVRVLNLFEVFEDQQLAVASFQ |
| Ga0187768_10585961 | 3300020150 | Tropical Peatland | IGILVRSLTTVKQRGGAVKLVSPSKFALQTLKLVGVANLFEIFDDEDAAVGSFA |
| Ga0210401_113644452 | 3300020583 | Soil | RYLTNAKQQGGDLKLLNPTKFALQTLKMIGLLNLFEVFQEQDEALAAFR |
| Ga0210406_102653513 | 3300021168 | Soil | GLLFRFLTAAKHRGGTLKLLNPSKFAVQTLKLVRVLNLFEIFDDLPLGVASFQSDDSLSK |
| Ga0210408_111067912 | 3300021178 | Soil | NGGSLKLLNPSKFALQTLKLVRVLSLFEVFEDPQLAVASFA |
| Ga0210397_105729652 | 3300021403 | Soil | LLVKVLTSAKQRGGSIKLLNPSKFTVQTLKMICLLDLFEVFDDQERAVASFG |
| Ga0210397_112434472 | 3300021403 | Soil | KQQGGAVKLLNPSKFTIQTLKLVRMLNLFEVFEDQQTALASFE |
| Ga0210383_111911931 | 3300021407 | Soil | SAKQRGGSIKLLNPSKFTVQTLKMICLLDLFEIFQDQQEAVASFG |
| Ga0126371_132171012 | 3300021560 | Tropical Forest Soil | LTAAKQRGGALRLLNPSKFVTQTLKMIGLLNLFEVFADQQQAVESFR |
| Ga0242665_100360883 | 3300022724 | Soil | GLLVRYLTAAKQQGGALKLLNPTKFAMQSLKMIGVLNLFEVYEDQEAALSSFK |
| Ga0209399_100997731 | 3300025157 | Thermal Springs | RSLTSAKQRGGSIKLVNPSKLAMQTLKIVGLLNLFEIFDDEAVAVESYS |
| Ga0208936_10012056 | 3300025404 | Peatland | LLNPSKFAVQTLRMTGLLSLFEMFEDQEQAVSSFE |
| Ga0209839_102673481 | 3300026294 | Soil | LLVRYYTSAKQNGGAVKLLNPSKFTIQTLKLVRMLNLFEVFEDPQVAVASFE |
| Ga0208237_10293412 | 3300027080 | Forest Soil | IKLLNPSKFTVQTLKMICLLDLFEIFQDQQQAVASFG |
| Ga0208984_10373532 | 3300027546 | Forest Soil | SGIGLLVRSLMNLKQQGGALKLLNPTKFAVQTLKMIGLLNQFEIFAEQQEALASFK |
| Ga0209733_10388421 | 3300027591 | Forest Soil | IKLLNPTKFAVQTLKMIGLLNLFEVFEEQEEALASFK |
| Ga0209329_10204491 | 3300027605 | Forest Soil | GIGLLVRHLTAVKQRGGSLKFLNPSKFAVQTLKLVRVLNLFEVFEDQQQAVASFN |
| Ga0209117_11460211 | 3300027645 | Forest Soil | AKQRGGSLKLLNPSKFALQTLKLVRVLNLFEVFEDQQLAVASFS |
| Ga0209117_11721172 | 3300027645 | Forest Soil | LLVRSLMNLKQQGGAIKLLNPTKFAVQTLKMIGLLNLFEVFEEQEEALASFK |
| Ga0209689_14076961 | 3300027748 | Soil | LLVRYLRTAKQNGGSLKLLNPSKFALQTLKLVRVLNLFEVFEDPEQAVASFGSPAF |
| Ga0209655_102214762 | 3300027767 | Bog Forest Soil | LVKVLTTSKQSGGSIKLLTPSKFVIQTLKMIGLLNLFDVFEDSQQAIASFGEA |
| Ga0209139_101174112 | 3300027795 | Bog Forest Soil | LKLLSPSKFTIQTLKLVRMLSLFEVFEDPQLAVASFE |
| Ga0209580_104150302 | 3300027842 | Surface Soil | GVLMKSLASARQRGGNIKLVNPSKFAVQTLRMVGLLNLFEVFTDADAAVASFA |
| Ga0209465_104486581 | 3300027874 | Tropical Forest Soil | LSAAKQRGGSLKLLNPSKFALQTLKLVRVLNLFEVFEDPQLAVASFQ |
| Ga0209283_101676933 | 3300027875 | Vadose Zone Soil | GGSLKLLNPSKFALQTLRLVRVLNLFEVFEDLQQAVASFS |
| Ga0209698_103794831 | 3300027911 | Watersheds | GSLKLLKPSKFALQTLRMIGLLGLFEVFDDQELAVASFS |
| Ga0302176_100412251 | 3300030057 | Palsa | IGILVRYLTTAKQSGGSIKLLNPSKFAVQTLKLVRVLSLFDVFEDQQQAIDSFQ |
| Ga0302180_105521431 | 3300031028 | Palsa | KQQGGAVKLLNPSKFTIQTLKLVRMLNLFEVFEDGQLAVASFE |
| Ga0170834_1107316961 | 3300031057 | Forest Soil | AAKQRGGSMKLLNPSKFALQTLKLVRVVNLFEIFEDQQAAVSSFQ |
| Ga0302307_106544411 | 3300031233 | Palsa | LVRYYTAAKQQGGAVKLLNPSKFTIQTLKLVRMLNLFEVFEDGQLAVASFE |
| Ga0318528_105393241 | 3300031561 | Soil | QGGALKLLKPTKFALQSLKMIGLLNLFEVFEDQDAAVSSFS |
| Ga0310686_1047057712 | 3300031708 | Soil | QGGSIKLLNPSKFTVQTLKMISLLDLFEIFEDQQAAVASFG |
| Ga0307474_100250963 | 3300031718 | Hardwood Forest Soil | GLLVKILTSAKQKGGSVKLLNPSKFTVQTLKMICLLDLFEIFDDQERAVASFG |
| Ga0307474_115118852 | 3300031718 | Hardwood Forest Soil | VKILTSAKQKGGSVKLLNPSKFTVQTLKMICLLDLFEVFDDQERAVASFG |
| Ga0318502_108753511 | 3300031747 | Soil | VRQMTMAKQRGGSLKLLKPSKFALQTLKVVRVLNLFEVFEEQQAAVESFQH |
| Ga0307475_108284142 | 3300031754 | Hardwood Forest Soil | LLVRYLTAAKQRGGSLKLLNPSKFALQTLKLVRVVNLFEIFEDQQLAVASFP |
| Ga0307475_113867831 | 3300031754 | Hardwood Forest Soil | GLLVRHLTAAKQRGGSLKLLNPSKFAVQTLKLVRVLNLFEVFEDQEQAVASFN |
| Ga0306925_108190801 | 3300031890 | Soil | LKPSKFALQTLKLVRVLNLFEVFEDQQLAVLSFQK |
| Ga0310909_113978362 | 3300031947 | Soil | IGLLVRQMTMAKQRGGSLKLLKPSKFALQTLKVVRVLNLFEVFEEQQAAVESFQH |
| Ga0307479_104337901 | 3300031962 | Hardwood Forest Soil | NLKQQGGAIKLLNPTKFAVQTLKMIGLLNLFEVFEEQQEALASFK |
| Ga0318532_101985472 | 3300032051 | Soil | YLTTAKQQGGALKLLKPTKFALQSLKMIGLLNLFEVFEDQDAAVSSFS |
| Ga0307471_1007687232 | 3300032180 | Hardwood Forest Soil | LLNPTKFALQTLKMIGLLNLFEVFQEQEKAVAAFK |
| Ga0307472_1022480991 | 3300032205 | Hardwood Forest Soil | LLVRYLTAAKQRGGSLKLLNPSKFALQTLKLVRVLNLFEVFEDQQQAVASFS |
| Ga0315286_106549263 | 3300032342 | Sediment | GVLVRSLTSAKQRGGALKLVNPSKLAVQTLKIVGLINLFEIFNDQAQAVESFG |
| ⦗Top⦘ |