


| Basic Information | |
|---|---|
| Family ID | F105619 |
| Family Type | Metagenome |
| Number of Sequences | 100 |
| Average Sequence Length | 41 residues |
| Representative Sequence | LIETLGHPLAPAYYIMLYGAIGLAIMWPMAETNTRALDE |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.00 % |
| % of genes near scaffold ends (potentially truncated) | 95.00 % |
| % of genes from short scaffolds (< 2000 bps) | 91.00 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (10.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.37% β-sheet: 0.00% Coil/Unstructured: 74.63% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF03466 | LysR_substrate | 6.00 |
| PF01292 | Ni_hydr_CYTB | 4.00 |
| PF00375 | SDF | 4.00 |
| PF00583 | Acetyltransf_1 | 3.00 |
| PF03551 | PadR | 2.00 |
| PF13090 | PP_kinase_C | 2.00 |
| PF00675 | Peptidase_M16 | 2.00 |
| PF02574 | S-methyl_trans | 2.00 |
| PF02219 | MTHFR | 2.00 |
| PF00033 | Cytochrome_B | 1.00 |
| PF13418 | Kelch_4 | 1.00 |
| PF13847 | Methyltransf_31 | 1.00 |
| PF03437 | BtpA | 1.00 |
| PF01564 | Spermine_synth | 1.00 |
| PF08281 | Sigma70_r4_2 | 1.00 |
| PF11937 | DUF3455 | 1.00 |
| PF07786 | HGSNAT_cat | 1.00 |
| PF13532 | 2OG-FeII_Oxy_2 | 1.00 |
| PF02371 | Transposase_20 | 1.00 |
| PF01980 | TrmO | 1.00 |
| PF02954 | HTH_8 | 1.00 |
| PF00830 | Ribosomal_L28 | 1.00 |
| PF03404 | Mo-co_dimer | 1.00 |
| PF01687 | Flavokinase | 1.00 |
| PF02798 | GST_N | 1.00 |
| PF06964 | Alpha-L-AF_C | 1.00 |
| PF00990 | GGDEF | 1.00 |
| PF09966 | DUF2200 | 1.00 |
| PF04893 | Yip1 | 1.00 |
| PF12704 | MacB_PCD | 1.00 |
| PF07883 | Cupin_2 | 1.00 |
| PF01648 | ACPS | 1.00 |
| PF07927 | HicA_toxin | 1.00 |
| PF04545 | Sigma70_r4 | 1.00 |
| PF02867 | Ribonuc_red_lgC | 1.00 |
| PF07366 | SnoaL | 1.00 |
| PF02482 | Ribosomal_S30AE | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG1969 | Ni,Fe-hydrogenase I cytochrome b subunit | Energy production and conversion [C] | 4.00 |
| COG2864 | Cytochrome b subunit of formate dehydrogenase | Energy production and conversion [C] | 4.00 |
| COG3038 | Cytochrome b561 | Energy production and conversion [C] | 4.00 |
| COG3658 | Cytochrome b subunit of Ni2+-dependent hydrogenase | Energy production and conversion [C] | 4.00 |
| COG4117 | Thiosulfate reductase cytochrome b subunit | Inorganic ion transport and metabolism [P] | 4.00 |
| COG0646 | Methionine synthase I (cobalamin-dependent), methyltransferase domain | Amino acid transport and metabolism [E] | 2.00 |
| COG0685 | 5,10-methylenetetrahydrofolate reductase | Amino acid transport and metabolism [E] | 2.00 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 2.00 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 2.00 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 2.00 |
| COG2040 | Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) | Amino acid transport and metabolism [E] | 2.00 |
| COG0196 | FAD synthase | Coenzyme transport and metabolism [H] | 1.00 |
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 1.00 |
| COG0227 | Ribosomal protein L28 | Translation, ribosomal structure and biogenesis [J] | 1.00 |
| COG0434 | Membrane biogenesis protein, BtpA/SgcQ family | Cell wall/membrane/envelope biogenesis [M] | 1.00 |
| COG1290 | Cytochrome b subunit of the bc complex | Energy production and conversion [C] | 1.00 |
| COG1544 | Ribosome-associated translation inhibitor RaiA | Translation, ribosomal structure and biogenesis [J] | 1.00 |
| COG1720 | tRNA (Thr-GGU) A37 N6-methylase | Translation, ribosomal structure and biogenesis [J] | 1.00 |
| COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 1.00 |
| COG3503 | Uncharacterized membrane protein, DUF1624 family | Function unknown [S] | 1.00 |
| COG3534 | Alpha-L-arabinofuranosidase | Carbohydrate transport and metabolism [G] | 1.00 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.00 % |
| Unclassified | root | N/A | 27.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000789|JGI1027J11758_12677649 | Not Available | 563 | Open in IMG/M |
| 3300000955|JGI1027J12803_109589589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 672 | Open in IMG/M |
| 3300002070|JGI24750J21931_1084146 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 532 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100827931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 806 | Open in IMG/M |
| 3300004114|Ga0062593_102459736 | Not Available | 589 | Open in IMG/M |
| 3300004463|Ga0063356_100102101 | All Organisms → cellular organisms → Bacteria | 3115 | Open in IMG/M |
| 3300004643|Ga0062591_100514773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1032 | Open in IMG/M |
| 3300004808|Ga0062381_10382679 | Not Available | 536 | Open in IMG/M |
| 3300005331|Ga0070670_101052019 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300005332|Ga0066388_103834974 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300005353|Ga0070669_100475190 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1033 | Open in IMG/M |
| 3300005353|Ga0070669_101433375 | Not Available | 600 | Open in IMG/M |
| 3300005367|Ga0070667_101159446 | Not Available | 723 | Open in IMG/M |
| 3300005466|Ga0070685_11065808 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300005467|Ga0070706_101064209 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 745 | Open in IMG/M |
| 3300005562|Ga0058697_10298677 | Not Available | 767 | Open in IMG/M |
| 3300005563|Ga0068855_102006511 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 584 | Open in IMG/M |
| 3300005833|Ga0074472_10632230 | All Organisms → cellular organisms → Bacteria | 1616 | Open in IMG/M |
| 3300005843|Ga0068860_100875347 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300005843|Ga0068860_101178786 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300006042|Ga0075368_10282863 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300006175|Ga0070712_101229357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 652 | Open in IMG/M |
| 3300006224|Ga0079037_100114186 | All Organisms → cellular organisms → Bacteria | 2298 | Open in IMG/M |
| 3300006845|Ga0075421_100728376 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
| 3300006854|Ga0075425_102687958 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300006903|Ga0075426_10045340 | All Organisms → cellular organisms → Bacteria | 3142 | Open in IMG/M |
| 3300006954|Ga0079219_10646514 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 788 | Open in IMG/M |
| 3300009100|Ga0075418_10144833 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2528 | Open in IMG/M |
| 3300009156|Ga0111538_13915020 | All Organisms → cellular organisms → Bacteria → FCB group | 515 | Open in IMG/M |
| 3300009167|Ga0113563_12646046 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300009551|Ga0105238_12657639 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300009792|Ga0126374_11681118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 527 | Open in IMG/M |
| 3300010358|Ga0126370_12280168 | Not Available | 535 | Open in IMG/M |
| 3300010359|Ga0126376_10557635 | All Organisms → cellular organisms → Bacteria → Thermodesulfobacteria → Thermodesulfobacteria → Thermodesulfobacteriales → unclassified Thermodesulfobacteriales → Thermodesulfobacteriales bacterium | 1074 | Open in IMG/M |
| 3300010360|Ga0126372_12474108 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300010400|Ga0134122_13392145 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
| 3300012907|Ga0157283_10332522 | Not Available | 540 | Open in IMG/M |
| 3300012948|Ga0126375_10015221 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3417 | Open in IMG/M |
| 3300012951|Ga0164300_10914901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 556 | Open in IMG/M |
| 3300013297|Ga0157378_12969157 | Not Available | 526 | Open in IMG/M |
| 3300013306|Ga0163162_11907855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 680 | Open in IMG/M |
| 3300014318|Ga0075351_1153696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300014968|Ga0157379_10255791 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1590 | Open in IMG/M |
| 3300015200|Ga0173480_10847617 | Not Available | 588 | Open in IMG/M |
| 3300015264|Ga0137403_10854860 | Not Available | 762 | Open in IMG/M |
| 3300015371|Ga0132258_10601766 | All Organisms → cellular organisms → Bacteria | 2760 | Open in IMG/M |
| 3300015371|Ga0132258_10984470 | All Organisms → cellular organisms → Bacteria | 2131 | Open in IMG/M |
| 3300015371|Ga0132258_13760879 | Not Available | 1034 | Open in IMG/M |
| 3300017792|Ga0163161_10928718 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 739 | Open in IMG/M |
| 3300017965|Ga0190266_11293925 | Not Available | 512 | Open in IMG/M |
| 3300018429|Ga0190272_12357924 | Not Available | 575 | Open in IMG/M |
| 3300018433|Ga0066667_12141890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300020021|Ga0193726_1217586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 794 | Open in IMG/M |
| 3300023069|Ga0247751_1056064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 667 | Open in IMG/M |
| 3300023072|Ga0247799_1047803 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300024325|Ga0247678_1058381 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 629 | Open in IMG/M |
| 3300025322|Ga0209641_10804228 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300025327|Ga0209751_11173473 | Not Available | 564 | Open in IMG/M |
| 3300025907|Ga0207645_10889825 | Not Available | 605 | Open in IMG/M |
| 3300025915|Ga0207693_10970188 | Not Available | 650 | Open in IMG/M |
| 3300025923|Ga0207681_10233243 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
| 3300025923|Ga0207681_10249837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1384 | Open in IMG/M |
| 3300025925|Ga0207650_11421853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Nitratireductor → Nitratireductor soli | 590 | Open in IMG/M |
| 3300025930|Ga0207701_10430310 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1134 | Open in IMG/M |
| 3300025981|Ga0207640_10843016 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300026023|Ga0207677_11847608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 561 | Open in IMG/M |
| 3300026023|Ga0207677_12117224 | Not Available | 523 | Open in IMG/M |
| 3300026035|Ga0207703_11133504 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300026035|Ga0207703_11591036 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300026088|Ga0207641_11334185 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300026095|Ga0207676_11492550 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300027617|Ga0210002_1008586 | All Organisms → cellular organisms → Bacteria | 1556 | Open in IMG/M |
| 3300027866|Ga0209813_10215631 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300027871|Ga0209397_10276187 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300027871|Ga0209397_10311509 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300028381|Ga0268264_12417744 | Not Available | 531 | Open in IMG/M |
| 3300028809|Ga0247824_10788780 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 586 | Open in IMG/M |
| 3300028889|Ga0247827_10015379 | All Organisms → cellular organisms → Bacteria | 3086 | Open in IMG/M |
| 3300031720|Ga0307469_10191288 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1587 | Open in IMG/M |
| 3300031740|Ga0307468_101309083 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300031873|Ga0315297_10179638 | Not Available | 1734 | Open in IMG/M |
| 3300032001|Ga0306922_11203321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 771 | Open in IMG/M |
| 3300032017|Ga0310899_10196262 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300032173|Ga0315268_10134829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2339 | Open in IMG/M |
| 3300032173|Ga0315268_12708987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21 | 509 | Open in IMG/M |
| 3300032211|Ga0310896_10691022 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 577 | Open in IMG/M |
| 3300032342|Ga0315286_11635928 | Not Available | 612 | Open in IMG/M |
| 3300032397|Ga0315287_11727725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfocapsaceae → Desulfosediminicola → Desulfosediminicola ganghwensis | 699 | Open in IMG/M |
| 3300032401|Ga0315275_11050193 | Not Available | 893 | Open in IMG/M |
| 3300033408|Ga0316605_11477479 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300033413|Ga0316603_10200625 | All Organisms → cellular organisms → Bacteria | 1697 | Open in IMG/M |
| 3300033414|Ga0316619_10698510 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → Opitutus terrae → Opitutus terrae PB90-1 | 856 | Open in IMG/M |
| 3300033418|Ga0316625_102471528 | Not Available | 524 | Open in IMG/M |
| 3300033418|Ga0316625_102483284 | Not Available | 523 | Open in IMG/M |
| 3300033419|Ga0316601_102012725 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300033488|Ga0316621_10523001 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300033521|Ga0316616_100737795 | Not Available | 1186 | Open in IMG/M |
| 3300033521|Ga0316616_101713653 | Not Available | 823 | Open in IMG/M |
| 3300033521|Ga0316616_102865753 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300034056|Ga0373893_032703 | Not Available | 677 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 10.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 7.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 7.00% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 6.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.00% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 2.00% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 2.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.00% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.00% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 2.00% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.00% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.00% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.00% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 1.00% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Host-Associated | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300004808 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006042 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014318 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300023069 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S049-202B-5 | Environmental | Open in IMG/M |
| 3300023072 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6 | Environmental | Open in IMG/M |
| 3300024325 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19 | Environmental | Open in IMG/M |
| 3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027866 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300034056 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A3A4.3 | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J11758_126776492 | 3300000789 | Soil | TAPMVSNWLIETLKQPLAPVFYIIAYGVFGLVVMWPMAETNARRLDQ* |
| JGI1027J12803_1095895893 | 3300000955 | Soil | ISAWLIERFGQPLAPAYYVILHGVVGLALLLPMQETNTRSLGE* |
| JGI24750J21931_10841462 | 3300002070 | Corn, Switchgrass And Miscanthus Rhizosphere | RLGQPLAPAWYIMLYGVLGLIVMVSMKETNTRALDEVVA* |
| JGIcombinedJ26739_1008279311 | 3300002245 | Forest Soil | ETLGQPLAPAYYVMLHGALGLALMWPMQETNSRVLDE* |
| Ga0062593_1024597361 | 3300004114 | Soil | LIERFSQPLAPAYYIMLYGAIGLALMWPMQETNARRLDL* |
| Ga0063356_1001021011 | 3300004463 | Arabidopsis Thaliana Rhizosphere | PLVSTWLVERFGQPLVPAWYIMLYGLIGLAVIWPMSETNTRRLDQ* |
| Ga0062591_1005147732 | 3300004643 | Soil | VAAWLVDALGKPLAPAYYIMLYGAIGLALMWPMSETNARHLDE* |
| Ga0062381_103826792 | 3300004808 | Wetland Sediment | LVSSWLIETLGHPLAPAYYIMLYGAIGLLIMWPMRETNTRALDE* |
| Ga0070670_1010520193 | 3300005331 | Switchgrass Rhizosphere | LVATWLIERFSQPLAPAYYIMLYGAIGLALMWPMQETNARPLDL* |
| Ga0066388_1038349741 | 3300005332 | Tropical Forest Soil | ALAGGTAPMVSNWLIETLKQPFAPVFYIIAYGVFGLVVMWPMAETNARRLDE* |
| Ga0070669_1004751902 | 3300005353 | Switchgrass Rhizosphere | AAWLIDTLGEPLAPAYYIMLYGVIGLALLWPMAETNGRRLDQ* |
| Ga0070669_1014333751 | 3300005353 | Switchgrass Rhizosphere | VATWLIERFSQPLAPAYYIMLYGAIGLALMWPMQETNARRLDL* |
| Ga0070667_1011594461 | 3300005367 | Switchgrass Rhizosphere | PLVSAWLIQHFGVPLAPAYYVMLHGAVGLALLWPMQETNTRSLSD* |
| Ga0070685_110658081 | 3300005466 | Switchgrass Rhizosphere | LAGGLAPLVATWLITMFPGVPMLPAYYIMLYGAIGLALMLPMKETNLRSLDE* |
| Ga0070706_1010642091 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | WLIQTLGHPLAPAYYIMLYGAIGLALMWPMAETNARALDT* |
| Ga0058697_102986771 | 3300005562 | Agave | VERLDQPLAPAFYIMLHGAIGLALMLPMRETNTRSLGE* |
| Ga0068855_1020065111 | 3300005563 | Corn Rhizosphere | VSAWLIEHFGQPLAPAYYVMLHGVIGLALMWPMEETNTRVLNE* |
| Ga0074472_106322303 | 3300005833 | Sediment (Intertidal) | ETLGHPLAPAYYIMLYGAIGLLIMWPMRETNTRALDE* |
| Ga0068860_1008753471 | 3300005843 | Switchgrass Rhizosphere | WLIDTFGQPLAPAYYIMLYGVIGLALMATMKETNARSLDV* |
| Ga0068860_1011787861 | 3300005843 | Switchgrass Rhizosphere | WLIKTYANEMLPAYYIMLYGVVGLALLWPMKETNARSLD* |
| Ga0075368_102828631 | 3300006042 | Populus Endosphere | HEPLAPAYYILLHGLIGLLLMLPMKETNTRSLDE* |
| Ga0070712_1012293572 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LVSAWLIQHFGVPLAPAYYVMLHGAVGLALLWPMQETNTRSLSD* |
| Ga0079037_1001141863 | 3300006224 | Freshwater Wetlands | TETLGHPLAPAYYIMLYGALGLLIMWPMRETNTRALDE* |
| Ga0075421_1007283764 | 3300006845 | Populus Rhizosphere | PLVSTWLVERFGQPLVPAWYIMLYGLIGLVIMWPMSETNARRLDE* |
| Ga0075425_1026879581 | 3300006854 | Populus Rhizosphere | GHEPAPAYYIMLLGAIGIAVMWRMPETNSRVLDA* |
| Ga0075426_100453403 | 3300006903 | Populus Rhizosphere | LVNSNATVGHPLAPAYYIMVYGAIGLALMWPMTETNNRPLGE* |
| Ga0079219_106465142 | 3300006954 | Agricultural Soil | GLAPLVATWLIKTYADAMLPAYYIMLYGVVGLALLWPMKETNARSLD* |
| Ga0075418_101448331 | 3300009100 | Populus Rhizosphere | RFGQPLVPAWYIMIYGLIGLFIMWPMSETNTRRLDQ* |
| Ga0111538_139150201 | 3300009156 | Populus Rhizosphere | GQPLVPAWYIMIYGLIGLFIMWPMSETNTRRLDQ* |
| Ga0113563_126460461 | 3300009167 | Freshwater Wetlands | GHPLAPAYYIMLYGALGLLIMWPMRETNTRALDE* |
| Ga0105238_126576391 | 3300009551 | Corn Rhizosphere | APLVSGWLIERFQQPLAPAYYIMLYGAIGLAVIWPMQETNTRRLDE* |
| Ga0126374_116811182 | 3300009792 | Tropical Forest Soil | EKFGAPLAPAWYVMLHGLIGLALLWSMQETNSRTLSD* |
| Ga0126370_122801681 | 3300010358 | Tropical Forest Soil | QRFALPLAPAYYVMLHGAIGLALLWPMQETNTHNLSE* |
| Ga0126376_105576352 | 3300010359 | Tropical Forest Soil | LIERFGDALMPAYYIMLYGVVGLVILWPMAETNARTLEA* |
| Ga0126372_124741082 | 3300010360 | Tropical Forest Soil | QQPLAPAYYIMLYGAIGLAVIWPMQETNARRLGE* |
| Ga0134122_133921451 | 3300010400 | Terrestrial Soil | DKLHQPLAPAYYIFFYGLLGLAIMWPMKETNSRRLDQ* |
| Ga0157283_103325222 | 3300012907 | Soil | MKQPLAPAYYVFLYGVLGLAIMWPMKETNTRRLDQ* |
| Ga0126375_100152211 | 3300012948 | Tropical Forest Soil | FGQPLAPAYYIMVYGVIGLALMAPMEETNERRLDR* |
| Ga0164300_109149012 | 3300012951 | Soil | FGQPLAPAYYIMLYGAIGLGLMATMKETNARRLDV* |
| Ga0157378_129691572 | 3300013297 | Miscanthus Rhizosphere | STWLIDCFGDPLMPAYYIMLYGIIGLAMLWPMAETDARSLEA* |
| Ga0163162_119078552 | 3300013306 | Switchgrass Rhizosphere | LQQPLAPAYYIMLYGAIGLAVIWPMQETNTRTLGE* |
| Ga0075351_11536962 | 3300014318 | Natural And Restored Wetlands | MKQPLAPAYYVFLYGFIGLAIMWPMKETNTRRLDQ* |
| Ga0157379_102557914 | 3300014968 | Switchgrass Rhizosphere | LIQHFGVPLAPAYYVMLHGAVGLALLWPMQETNTRSLSD* |
| Ga0173480_108476172 | 3300015200 | Soil | IDTFGQPLAPAYYIMLYGVIGLALMATMKETNARSLDV* |
| Ga0137403_108548602 | 3300015264 | Vadose Zone Soil | IQHFGAPLAPAYYVMLHGAIGLALLWPMQETNTHSLSD* |
| Ga0132258_106017661 | 3300015371 | Arabidopsis Rhizosphere | TWLIERFSQPLAPAYYIMLYGAIGLALMWPMQETNANRLDE* |
| Ga0132258_109844702 | 3300015371 | Arabidopsis Rhizosphere | GWLIDTMKQPLAPAYYVFLYGLIGLAIMWPMAETNARRLDQ* |
| Ga0132258_137608791 | 3300015371 | Arabidopsis Rhizosphere | TLALAGGTAPMVSNWLIETLKQPLAPVFYIIAYGVFGLLVMWPMAETNARRLDQ* |
| Ga0163161_109287182 | 3300017792 | Switchgrass Rhizosphere | WLIDTLGEPLAPAWYIMLYGVIGLALLWPMSETNGRRLDQ |
| Ga0190266_112939252 | 3300017965 | Soil | LIDTMKQPLAPAYYVFLYGALGLAIMWPMKETNTRRLDL |
| Ga0190272_123579242 | 3300018429 | Soil | LVSTWLVERLGEPLAPAWYIMMYGAIGLALMWPMKETNTHTLDE |
| Ga0066667_121418902 | 3300018433 | Grasslands Soil | IEKLGHPLAPAYYIMMYGAIGLALMWPMQETNNRPLGD |
| Ga0193726_12175862 | 3300020021 | Soil | SAWLIERFGVLLAPAYYVMLHGAIGLALLWPMQETNTRTLSD |
| Ga0247751_10560642 | 3300023069 | Soil | LIDTMKQPLAPAYYVFLYGLLGLALMWPMKETNSRRLDQ |
| Ga0247799_10478031 | 3300023072 | Soil | LVERFGQPLVPAWYIMIYGLIGLFIMWPMSETNTRRLDQ |
| Ga0247678_10583811 | 3300024325 | Soil | AWLIGKFGVPLAPAYYVMLHGAIGLALLWPMQETNARTLSE |
| Ga0209641_108042281 | 3300025322 | Soil | APLVSTWLIETLGHPLAPAYYIMLYGAIGLAIMWPMAETNTRRLDV |
| Ga0209751_111734732 | 3300025327 | Soil | ALAGGTAPTVSKWFIDTLHQPLWPAFYIMAYGVLGLAIMWPMRETNTRPLDR |
| Ga0207645_108898251 | 3300025907 | Miscanthus Rhizosphere | WLIERFQQPLAPAYYIMLYGAIGLAVIWPMQETNTRRLDE |
| Ga0207693_109701881 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LVSAWLIQHFGVPLAPAYYVMLHGAVGLALLWPMQETNTRSLSD |
| Ga0207681_102332431 | 3300025923 | Switchgrass Rhizosphere | PLVATWLIDTMKQPLAPAYYVFLYGVLGLAIMWPMKETNTRRLDT |
| Ga0207681_102498373 | 3300025923 | Switchgrass Rhizosphere | LVAAWLIDTLGEPLAPAYYIMLYGVIGLALLWPMAETNGRRLDQ |
| Ga0207650_114218532 | 3300025925 | Switchgrass Rhizosphere | TMKQPLAPAYYVFLYGLIGLAIMWPIKETNTRRLDQ |
| Ga0207701_104303103 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | WLIDTMKQPLAPAYYVFLYGLLGLAIMWPMKETNTRRLDQ |
| Ga0207640_108430161 | 3300025981 | Corn Rhizosphere | LIQHFGVPLAPAYYVMLHGAVGLALLWPMQETNTRSLSD |
| Ga0207677_118476081 | 3300026023 | Miscanthus Rhizosphere | QHFGVPLAPAYYVMLHGAVGLALLWPMQETNTRSLSD |
| Ga0207677_121172242 | 3300026023 | Miscanthus Rhizosphere | LGDSLAPAFYVMLYGVIGAALIWPMKETNTRQLTA |
| Ga0207703_111335042 | 3300026035 | Switchgrass Rhizosphere | SAPFVSTWLIDCFGDPLMPAYYIMLYGIIGLAMLWPMAETNARSLEA |
| Ga0207703_115910362 | 3300026035 | Switchgrass Rhizosphere | WLIETLGQPLAPAHYIVVYGAIGLALMWPMQETNTRPLDR |
| Ga0207641_113341851 | 3300026088 | Switchgrass Rhizosphere | LTLALAGGTAPMVSNWLIETLKQPLAPVFYIIAYGLFGLVVMWPMAETNARRLDQ |
| Ga0207676_114925501 | 3300026095 | Switchgrass Rhizosphere | LIDTLKQPLAPVYYVFLYGLIGLAIMWPMKETNARPLDQ |
| Ga0210002_10085864 | 3300027617 | Arabidopsis Thaliana Rhizosphere | APLVSTWLVERFGQPLVPAWYIMIYGLIGLFIMWPMSETNTRRLDQ |
| Ga0209813_102156312 | 3300027866 | Populus Endosphere | FHEPLAPAYYILLHGLIGLLLMLPMKETNTRSLDE |
| Ga0209397_102761872 | 3300027871 | Wetland | TAPLVSSWLIETLGHPLAPAYYIMLYGAVGLLIMWPMRETNTRALDE |
| Ga0209397_103115092 | 3300027871 | Wetland | WLTETLGHPLAPAYYIMLYGALGLLIMWPMRETNTRALDE |
| Ga0268264_124177441 | 3300028381 | Switchgrass Rhizosphere | IDTFGQPLAPAYYIMLYGVIGLALMATMKETNARSLDV |
| Ga0247824_107887801 | 3300028809 | Soil | IDTLGEPLAPAYYIMLYGVIGLALLWPMAETNGRRLDQ |
| Ga0247827_100153793 | 3300028889 | Soil | VAAWLVDALGKPLAPAYYIMLYGAIGLAVMWPMSETNARHLDE |
| Ga0307469_101912883 | 3300031720 | Hardwood Forest Soil | GTAPRVSNWLIETLKQPLAPVLYIITYGVIGLAIMWPMHETNARRLDE |
| Ga0307468_1013090832 | 3300031740 | Hardwood Forest Soil | VSGWLIERLQQPLAPAYYIMAYGAIGLAVIWPMQETNTRRLGE |
| Ga0315297_101796381 | 3300031873 | Sediment | ETLGHPLAPAYYIMLYGAVGLAIMWPMAETNGRRLDE |
| Ga0306922_112033211 | 3300032001 | Soil | SAWLIERFAWPLAPAYYVMLHGAIGLALLWPMQETNTQTLSD |
| Ga0310899_101962622 | 3300032017 | Soil | SAPLVSTWLVERFGQPLVPAWYIMIYGLIGLFIMWPMSETNTRRLDQ |
| Ga0315268_101348291 | 3300032173 | Sediment | ETLGHPLAPAYYIMLYGAIGLAIMWPMRETNTRSLDD |
| Ga0315268_127089872 | 3300032173 | Sediment | APLVSAWLIETLGHPLAPAYYIMLYGALGLAIMWPMAETNTRALDT |
| Ga0310896_106910222 | 3300032211 | Soil | LGEPLAPAYYIMLYGVIGLALLWPMSETNGRRLDQ |
| Ga0315286_116359282 | 3300032342 | Sediment | PLVSTWLIETLGHPLAPAYYIMLYGAVGLAIMWPMAETNARRLDV |
| Ga0315287_117277251 | 3300032397 | Sediment | ETLGHPLAPAYYIMLYGAIGLLIMWPMRETNTRALDE |
| Ga0315275_110501932 | 3300032401 | Sediment | TAPMVSKWLIETFGHPLLPAYYIMLYGAIGLAIMWPMAETNTRRLDE |
| Ga0316605_114774792 | 3300033408 | Soil | APLVSSWLIETLGHPLAPAYYIMLYGAIGLLIMWPMRETNTRALDE |
| Ga0316603_102006252 | 3300033413 | Soil | PLVSSWLTETLGHPLAPAYYIMLYGALGLLIMWPMRETNTRALDE |
| Ga0316619_106985101 | 3300033414 | Soil | SWLIETLGHPLAPAYYIMLFGAIGLLMVWPMRETNTRALDE |
| Ga0316625_1024715281 | 3300033418 | Soil | FGSPMLPAYYVIIYGAIGLAIMWPMQETNTRSLDD |
| Ga0316625_1024832841 | 3300033418 | Soil | TETLGHPLAPAYYIMLYGALGLLIMWPMRETNTRALDE |
| Ga0316601_1020127251 | 3300033419 | Soil | APLVSSWLIEHFHNPLVPAYYIMAYGIIGLAIMWPMGETNTRSLDR |
| Ga0316621_105230011 | 3300033488 | Soil | ETLGHPLAPAYYIMLYGAIGLVIMWPMRETNTRALDE |
| Ga0316616_1007377952 | 3300033521 | Soil | VETLGHPLAPAYYIMLYGAVGLAIMWPMRETNTRALDE |
| Ga0316616_1017136532 | 3300033521 | Soil | LIETLGHPLAPAYYIMLYGAIGLAIMWPMAETNTRALDE |
| Ga0316616_1028657531 | 3300033521 | Soil | ERLGQPLAPAYYIMLHGLIGFCLMLPMKETNLRSLDE |
| Ga0373893_032703_2_142 | 3300034056 | Sediment Slurry | APLVSSWLVETLGHPLAPAYYIMLYGAAGLAIMWPMRETNTRALDE |
| ⦗Top⦘ |