


| Basic Information | |
|---|---|
| Family ID | F105519 |
| Family Type | Metagenome |
| Number of Sequences | 100 |
| Average Sequence Length | 43 residues |
| Representative Sequence | KEAAEKVCGLALTENGTLAQLRARVLTFGDLKQRSATSFYAVE |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.00 % |
| % of genes from short scaffolds (< 2000 bps) | 98.00 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (51.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (24.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (38.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.21% β-sheet: 0.00% Coil/Unstructured: 64.79% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF07883 | Cupin_2 | 25.00 |
| PF03401 | TctC | 1.00 |
| PF00596 | Aldolase_II | 1.00 |
| PF12860 | PAS_7 | 1.00 |
| PF11250 | FAF | 1.00 |
| PF00982 | Glyco_transf_20 | 1.00 |
| PF03006 | HlyIII | 1.00 |
| PF03707 | MHYT | 1.00 |
| PF03450 | CO_deh_flav_C | 1.00 |
| PF00578 | AhpC-TSA | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0380 | Trehalose-6-phosphate synthase, GT20 family | Carbohydrate transport and metabolism [G] | 1.00 |
| COG1272 | Predicted membrane channel-forming protein YqfA, hemolysin III family | Intracellular trafficking, secretion, and vesicular transport [U] | 1.00 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.00 |
| COG3300 | MHYT domain, NO-binding membrane sensor | Signal transduction mechanisms [T] | 1.00 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 51.00 % |
| Unclassified | root | N/A | 49.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908045|KansclcFeb2_ConsensusfromContig114426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 519 | Open in IMG/M |
| 3300000956|JGI10216J12902_100154926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1859 | Open in IMG/M |
| 3300000956|JGI10216J12902_102280600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 709 | Open in IMG/M |
| 3300005165|Ga0066869_10038752 | Not Available | 799 | Open in IMG/M |
| 3300005331|Ga0070670_100334534 | Not Available | 1328 | Open in IMG/M |
| 3300005336|Ga0070680_101724935 | Not Available | 543 | Open in IMG/M |
| 3300005457|Ga0070662_101427414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 596 | Open in IMG/M |
| 3300005467|Ga0070706_100792094 | Not Available | 878 | Open in IMG/M |
| 3300005547|Ga0070693_101003379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 632 | Open in IMG/M |
| 3300005548|Ga0070665_101827367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 614 | Open in IMG/M |
| 3300005719|Ga0068861_102606473 | Not Available | 509 | Open in IMG/M |
| 3300005764|Ga0066903_104181288 | Not Available | 772 | Open in IMG/M |
| 3300005841|Ga0068863_102465425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 529 | Open in IMG/M |
| 3300006178|Ga0075367_10811448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 596 | Open in IMG/M |
| 3300006791|Ga0066653_10150151 | Not Available | 1133 | Open in IMG/M |
| 3300007076|Ga0075435_100683258 | Not Available | 892 | Open in IMG/M |
| 3300007076|Ga0075435_101573491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 577 | Open in IMG/M |
| 3300009090|Ga0099827_11153727 | Not Available | 673 | Open in IMG/M |
| 3300009101|Ga0105247_10030343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3276 | Open in IMG/M |
| 3300009101|Ga0105247_11120178 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300009148|Ga0105243_11336242 | Not Available | 735 | Open in IMG/M |
| 3300009162|Ga0075423_12700086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300010043|Ga0126380_11374727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 619 | Open in IMG/M |
| 3300010046|Ga0126384_12271082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300010321|Ga0134067_10487126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 509 | Open in IMG/M |
| 3300010336|Ga0134071_10809002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 502 | Open in IMG/M |
| 3300010337|Ga0134062_10729882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 523 | Open in IMG/M |
| 3300010360|Ga0126372_12383674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 580 | Open in IMG/M |
| 3300010361|Ga0126378_12693564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 568 | Open in IMG/M |
| 3300010366|Ga0126379_12275902 | Not Available | 642 | Open in IMG/M |
| 3300010376|Ga0126381_103861437 | Not Available | 585 | Open in IMG/M |
| 3300010398|Ga0126383_12987691 | Not Available | 552 | Open in IMG/M |
| 3300010403|Ga0134123_12020574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 635 | Open in IMG/M |
| 3300012096|Ga0137389_10824924 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 796 | Open in IMG/M |
| 3300012189|Ga0137388_10781624 | Not Available | 885 | Open in IMG/M |
| 3300012948|Ga0126375_10768059 | Not Available | 759 | Open in IMG/M |
| 3300012948|Ga0126375_11649960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 554 | Open in IMG/M |
| 3300012951|Ga0164300_10134901 | Not Available | 1135 | Open in IMG/M |
| 3300012951|Ga0164300_10338895 | Not Available | 802 | Open in IMG/M |
| 3300012951|Ga0164300_10862156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 568 | Open in IMG/M |
| 3300012971|Ga0126369_10627618 | Not Available | 1147 | Open in IMG/M |
| 3300012971|Ga0126369_10795866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1027 | Open in IMG/M |
| 3300013102|Ga0157371_10712481 | Not Available | 752 | Open in IMG/M |
| 3300014968|Ga0157379_10956385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 815 | Open in IMG/M |
| 3300015358|Ga0134089_10540366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300015372|Ga0132256_101076234 | Not Available | 919 | Open in IMG/M |
| 3300015373|Ga0132257_100760247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1207 | Open in IMG/M |
| 3300016270|Ga0182036_11434076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 578 | Open in IMG/M |
| 3300016387|Ga0182040_11435327 | Not Available | 585 | Open in IMG/M |
| 3300017792|Ga0163161_10805914 | Not Available | 789 | Open in IMG/M |
| 3300018482|Ga0066669_11100432 | Not Available | 717 | Open in IMG/M |
| 3300021510|Ga0222621_1086317 | Not Available | 664 | Open in IMG/M |
| 3300025925|Ga0207650_11061637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 689 | Open in IMG/M |
| 3300025931|Ga0207644_11859920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 503 | Open in IMG/M |
| 3300025935|Ga0207709_11493442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 561 | Open in IMG/M |
| 3300025937|Ga0207669_10899690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 739 | Open in IMG/M |
| 3300025937|Ga0207669_11198771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 643 | Open in IMG/M |
| 3300026088|Ga0207641_12074307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 569 | Open in IMG/M |
| 3300026542|Ga0209805_1146930 | Not Available | 1088 | Open in IMG/M |
| 3300026557|Ga0179587_11158075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 509 | Open in IMG/M |
| 3300027874|Ga0209465_10513823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 598 | Open in IMG/M |
| 3300027874|Ga0209465_10549642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 575 | Open in IMG/M |
| 3300027903|Ga0209488_10139735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1828 | Open in IMG/M |
| 3300028536|Ga0137415_10532115 | Not Available | 984 | Open in IMG/M |
| 3300028704|Ga0307321_1013650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1389 | Open in IMG/M |
| 3300028784|Ga0307282_10303800 | Not Available | 769 | Open in IMG/M |
| 3300028819|Ga0307296_10774038 | Not Available | 523 | Open in IMG/M |
| 3300028828|Ga0307312_10240749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1169 | Open in IMG/M |
| 3300031226|Ga0307497_10068481 | Not Available | 1300 | Open in IMG/M |
| 3300031543|Ga0318516_10255411 | Not Available | 1013 | Open in IMG/M |
| 3300031545|Ga0318541_10619201 | Not Available | 605 | Open in IMG/M |
| 3300031546|Ga0318538_10576195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 610 | Open in IMG/M |
| 3300031572|Ga0318515_10340333 | Not Available | 804 | Open in IMG/M |
| 3300031680|Ga0318574_10330477 | Not Available | 887 | Open in IMG/M |
| 3300031680|Ga0318574_10349009 | Not Available | 863 | Open in IMG/M |
| 3300031723|Ga0318493_10652163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 588 | Open in IMG/M |
| 3300031724|Ga0318500_10521094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 598 | Open in IMG/M |
| 3300031765|Ga0318554_10660609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 587 | Open in IMG/M |
| 3300031771|Ga0318546_11236502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300031777|Ga0318543_10178085 | Not Available | 940 | Open in IMG/M |
| 3300031780|Ga0318508_1046484 | Not Available | 1138 | Open in IMG/M |
| 3300031792|Ga0318529_10184203 | Not Available | 966 | Open in IMG/M |
| 3300031819|Ga0318568_10760401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 601 | Open in IMG/M |
| 3300031832|Ga0318499_10102644 | Not Available | 1106 | Open in IMG/M |
| 3300031835|Ga0318517_10254631 | Not Available | 792 | Open in IMG/M |
| 3300031846|Ga0318512_10201519 | Not Available | 973 | Open in IMG/M |
| 3300031860|Ga0318495_10287733 | Not Available | 732 | Open in IMG/M |
| 3300031890|Ga0306925_10904345 | Not Available | 907 | Open in IMG/M |
| 3300031908|Ga0310900_10277528 | Not Available | 1220 | Open in IMG/M |
| 3300031942|Ga0310916_10678694 | Not Available | 872 | Open in IMG/M |
| 3300031942|Ga0310916_11038961 | Not Available | 682 | Open in IMG/M |
| 3300031945|Ga0310913_10022862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 3907 | Open in IMG/M |
| 3300031954|Ga0306926_11074388 | Not Available | 953 | Open in IMG/M |
| 3300031954|Ga0306926_12165542 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 620 | Open in IMG/M |
| 3300032013|Ga0310906_10090394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1650 | Open in IMG/M |
| 3300032013|Ga0310906_10398389 | Not Available | 908 | Open in IMG/M |
| 3300032068|Ga0318553_10222688 | Not Available | 984 | Open in IMG/M |
| 3300032089|Ga0318525_10547257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 591 | Open in IMG/M |
| 3300032094|Ga0318540_10432763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 635 | Open in IMG/M |
| 3300033551|Ga0247830_10447008 | Not Available | 1011 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 24.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.00% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028704 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KansclcFeb2_06175230 | 2124908045 | Soil | SEREAAEKVCGRALTNRGTLAQLRARVLTFGDFKQRSATSFYAAE |
| JGI10216J12902_1001549263 | 3300000956 | Soil | EAGRLAQLRARVLTLGDLRQTRATPFYAVERGTL* |
| JGI10216J12902_1022806003 | 3300000956 | Soil | SREHNWKKVVAGSAKEAAEKVCGRALKQDGKLAQLRARVLALGDLKQRSATPFYDAD* |
| Ga0066869_100387522 | 3300005165 | Soil | VEAASAKEAAEKVCGRALKQDGKLAQLRARVLTLGDLKQRSATEFYAAE* |
| Ga0070670_1003345341 | 3300005331 | Switchgrass Rhizosphere | AEKVCGRALKQDGKLAQLRARVLTLGDLKQRSATPFYDAD* |
| Ga0070680_1017249351 | 3300005336 | Corn Rhizosphere | EAAEKVCGRALKPDGKLAQLRARVLTLGDLKQWSATPFYDAE* |
| Ga0070662_1014274141 | 3300005457 | Corn Rhizosphere | AEKVCGRALKQDGKLAQLRARVLTLGDLKQRSATPFYDAE* |
| Ga0070706_1007920941 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | AASEKEAAEKVCGLALSEHGTLAQLRARVLTFGDLKQRSATSFYIVE* |
| Ga0070693_1010033791 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | EHNWKKVEAASEKEAAEKVCGRALKPDGKLAQLRARVLTLGDLKQRSATPFYAAE* |
| Ga0070665_1018273671 | 3300005548 | Switchgrass Rhizosphere | ASEKEAAEKVCGRALKPDGKLAQLRARVLTLGDLKQRSATPFYDAE* |
| Ga0068861_1026064731 | 3300005719 | Switchgrass Rhizosphere | RALKQDGKLAQLRARVLTLGDLKQRSATPFYDAD* |
| Ga0066903_1041812881 | 3300005764 | Tropical Forest Soil | RKVEAASAKEAAEKMCGAALVEHGRLAQLRARVLAVGDLKQRSATAFYAPE* |
| Ga0068863_1024654251 | 3300005841 | Switchgrass Rhizosphere | GRALKQDGKLAQLRARVLTLGDLKQRSATPFYDAE* |
| Ga0075367_108114481 | 3300006178 | Populus Endosphere | NWKKVVAGSAKEAAEKVCGRPLKQDGKLAQLRARVLAFGDLKQHSATEFYAAD* |
| Ga0066653_101501513 | 3300006791 | Soil | LALTDNGTLAQLRARVLTFGDLKQRSATSFYAVE* |
| Ga0075435_1006832581 | 3300007076 | Populus Rhizosphere | KVCGLPLTERGTLAQLRARVLAFGDLKQRSATSFYAAK* |
| Ga0075435_1015734911 | 3300007076 | Populus Rhizosphere | NWKKVEAASEKEAAEKVCGRALKQNGKLAQLRARVLTLGDLKQRSATPFYAAE* |
| Ga0099827_111537271 | 3300009090 | Vadose Zone Soil | AAEKVCGLALTDNGTLARLRARVLTFGDLKQRSATSFYAAE* |
| Ga0105247_100303435 | 3300009101 | Switchgrass Rhizosphere | RALKQDGKLAQLRARVLTLGDLKQRSATPFYDAE* |
| Ga0105247_111201782 | 3300009101 | Switchgrass Rhizosphere | EKVCGRALKQDGKLAQLRARVLTLGDLKQRSATPFYDAE* |
| Ga0105243_113362423 | 3300009148 | Miscanthus Rhizosphere | AKEAAEKVCGRPLKQDGKLAQLRARVLALGDLKQHSATPFYDAD* |
| Ga0075423_127000862 | 3300009162 | Populus Rhizosphere | AEKVCGLPLTERGTLAQLRARVLTFGDLKQRTATPFFAAD* |
| Ga0126380_113747272 | 3300010043 | Tropical Forest Soil | EKVCGLALTEHGTLAQLRARVLTFGDLKQRSATSFYVVK* |
| Ga0126384_122710821 | 3300010046 | Tropical Forest Soil | EKEAAEKVCGLALTANGTLAQLRARVLTFGDLKQRSATSFYAVE* |
| Ga0134067_104871261 | 3300010321 | Grasslands Soil | AAEKVCGLPLTERGTLAQLRARVLTFGDLKQRSATSFYAASRR* |
| Ga0134071_108090021 | 3300010336 | Grasslands Soil | LALTDNGTLAQLRARVLTFGDLKRRSATSFYAVE* |
| Ga0134062_107298821 | 3300010337 | Grasslands Soil | AASDKEAAEKVCGRALSNRGTLAQLRARVLTFGDFKQRSATSFYAAE* |
| Ga0126372_123836742 | 3300010360 | Tropical Forest Soil | EAAEKVCGLALTEHGTLAQLRARVLTFGNLKQRSATSFYIVE* |
| Ga0126378_126935641 | 3300010361 | Tropical Forest Soil | EAAEKVCGLTLTERGTLAQPRARVLTFGDLKQRSATSFYAAE* |
| Ga0126379_122759022 | 3300010366 | Tropical Forest Soil | CGLALTDNGTLAQLRARVLTFGDLKQRSATSFYAAE* |
| Ga0126381_1038614371 | 3300010376 | Tropical Forest Soil | KEAAERVCGLRLTERGTLAQLRARVLTFGDLKQRSATSFYAAN* |
| Ga0126383_129876911 | 3300010398 | Tropical Forest Soil | EAAEKVCGRALIETGRLSQLRARVLQLGDLKQRSATPFYAAEEVGG* |
| Ga0134123_120205742 | 3300010403 | Terrestrial Soil | AKEAAEKVCGRALKQDGKLAQLRARVLTLGDLKQRSATPFYDAE* |
| Ga0137389_108249241 | 3300012096 | Vadose Zone Soil | SEKEAAEKVCGIILAEIGTLAQLRARVLRFGDLKQHSATAFYAAGE* |
| Ga0137388_107816241 | 3300012189 | Vadose Zone Soil | LALTEAGRLSQLRARVLPFGDLKQRSATAFYAAE* |
| Ga0126375_107680591 | 3300012948 | Tropical Forest Soil | IEAATAKQAAEKVCGVALTDQGTLARLRARVLVFGDIKQRSATPFYAAD* |
| Ga0126375_116499602 | 3300012948 | Tropical Forest Soil | GLALTEHGTLAQLRARVLTFGNLKQRSATSFYIVE* |
| Ga0164300_101349011 | 3300012951 | Soil | AAEKVCGRALKQDGKLAQLRARVLTLGDLKQRSATPFYDAD* |
| Ga0164300_103388951 | 3300012951 | Soil | GRALKQDGKLAQLRARVLALGDLKQRSATPFYAAE* |
| Ga0164300_108621561 | 3300012951 | Soil | AAEKVCGRALKQDGKLAQLRARVLTLGDLKQRSATPFYDAE* |
| Ga0126369_106276181 | 3300012971 | Tropical Forest Soil | EKVCGLTLTERGTLAQLRARVLTFGDLKQRSATSFYAVE* |
| Ga0126369_107958661 | 3300012971 | Tropical Forest Soil | MDNWCKIEAATAKQAAEKVCGVALTDQGTLARLRARVLVFGDLKQRSATPFYAAD* |
| Ga0157371_107124812 | 3300013102 | Corn Rhizosphere | EAASAKEAAEKVCGRALKQDGKLAQLRARVLTLGDLKQRSATPFYDAD* |
| Ga0157379_109563851 | 3300014968 | Switchgrass Rhizosphere | NWKKVEAASAKAAAEKVCGRALKPDGKLAQLRARVLTLGDLKQRSATPFYDAE* |
| Ga0134089_105403661 | 3300015358 | Grasslands Soil | SEKEAAEKVCGLALTQRGTLAQLRARVLTFGDLKQRTATPFFAVE* |
| Ga0132256_1010762342 | 3300015372 | Arabidopsis Rhizosphere | EKEAAEKVCGLALTDNGTLARLRARVLTFGDLKQRSATSFYAVE* |
| Ga0132257_1007602471 | 3300015373 | Arabidopsis Rhizosphere | EAAEMVCGLPLSEQGQLSRLRARVLKFGDLKQRSATSFYAAE* |
| Ga0182036_114340762 | 3300016270 | Soil | GLALTEHGTLAQLRARVLTFGDLKQRSATSFYIVD |
| Ga0182040_114353271 | 3300016387 | Soil | RKVKASSAKEAAEKVCGRALSEAGRHSQLRARVLKFGDLRQRSAAEFYAVD |
| Ga0163161_108059141 | 3300017792 | Switchgrass Rhizosphere | CGLPLTERGTLAQLRARVLAFGDLKQRSATSFYAAK |
| Ga0066669_111004321 | 3300018482 | Grasslands Soil | VCGLNLTHRGTLAQLRARVLTFGALKHRTATPFRVVE |
| Ga0222621_10863171 | 3300021510 | Groundwater Sediment | EKVCGRPLKQDGKLAQLRARVLTLGDLKQHSATAFYAAE |
| Ga0207650_110616372 | 3300025925 | Switchgrass Rhizosphere | EAAEKVCGRALKQDGKLAQLRARVLTLGDLKQRSATPFYDAD |
| Ga0207644_118599201 | 3300025931 | Switchgrass Rhizosphere | ASAKAAAEKVCGRALKPDGKLAQLRARVLTLGDLKQRSATPFYDAE |
| Ga0207709_114934421 | 3300025935 | Miscanthus Rhizosphere | KVEVASAKEAAEKVCGRALKQDGKLAQLRARVLTLGDLKQRSATPFYDAD |
| Ga0207669_108996902 | 3300025937 | Miscanthus Rhizosphere | VCGRPLKQDGKLAQLRARVLAFGDLKQHSATEFYAAD |
| Ga0207669_111987712 | 3300025937 | Miscanthus Rhizosphere | EAASEKEAAEKVCGRALKPDGKLAQLRARVLTLGDLKQRSATPFYDAE |
| Ga0207641_120743071 | 3300026088 | Switchgrass Rhizosphere | EAASAKEAAEKVCGRALKQDGKLAQLRARVLTLGDLKQRSATPFYDAE |
| Ga0209805_11469305 | 3300026542 | Soil | AASEKEAAEKICGRALNKRGNLAQLRARVLALGDLKQHTATPFYAAD |
| Ga0179587_111580752 | 3300026557 | Vadose Zone Soil | VCGLALTEAGKLAQLRARVLKFGDLKQRSATQFYAVE |
| Ga0209465_105138231 | 3300027874 | Tropical Forest Soil | KEAAEKVCGLALTEHGTLAQLRARVLTFGDLKRRSATSFYIVE |
| Ga0209465_105496421 | 3300027874 | Tropical Forest Soil | KEAAEKVCGLALTEHGTLAQLRARVLTFGDLKQRSATSFYIVE |
| Ga0209488_101397354 | 3300027903 | Vadose Zone Soil | EKEAAEKVCGLELRDCGTLAQLRARVLTFGNLKQRTATPFYAAE |
| Ga0137415_105321151 | 3300028536 | Vadose Zone Soil | KVCGLALRDCGTLAQLRARVLTFGNLKQRTATPFYAAE |
| Ga0307321_10136501 | 3300028704 | Soil | EKEAAEKVCGRPLKQDGKLAQLRARVLTLGDLKQHSATAFYAAE |
| Ga0307282_103038001 | 3300028784 | Soil | KKVEAASAKEAAEKVCGRALKQDGKLAQLRARVLALGDLKQRSATPFYDAE |
| Ga0307296_107740381 | 3300028819 | Soil | KVCGRALKQDGKLAQLRARVLTLGDLKQHSATAFYAAE |
| Ga0307312_102407493 | 3300028828 | Soil | SAKEAAEKVCGRALKQDGKLAQLRARVLTLGDLKQRSATPFYDAE |
| Ga0307497_100684811 | 3300031226 | Soil | CGRALKQDGKLAQLRARVLTLGDLKQRSATEFYAAE |
| Ga0318516_102554111 | 3300031543 | Soil | KEAAEKVCGLALTENGTLAQLRARVLTFGDLKQRSATSFYAVK |
| Ga0318541_106192011 | 3300031545 | Soil | WDREQNWRKVEASSAKEAAEKVCGRVLSGAGRHSQLRARVLKFCDLRQRSAMEFYAID |
| Ga0318538_105761952 | 3300031546 | Soil | ASEKEAAEKVCGLALTEHGTLAQLRARVLTFGDLKQRSATSFYIVE |
| Ga0318515_103403331 | 3300031572 | Soil | CGLALTANGTLAQLRARVLTFGDLKQRSATSFYAVE |
| Ga0318574_103304771 | 3300031680 | Soil | KEAAEKVCGLALTDNGTLAQLRARVLTFGDLKQRSATSFYAVE |
| Ga0318574_103490091 | 3300031680 | Soil | KVCGLALTENGTLAQLRARVLTFGDLKQRSATSFYAVE |
| Ga0318493_106521631 | 3300031723 | Soil | CGLALTEHGTLAQLRARVLTFGDLKQRSATSFYIVD |
| Ga0318500_105210942 | 3300031724 | Soil | EKVCGLALTEHGTLAQLRARVLTFGDLKQRSATSFYIVD |
| Ga0318554_106606092 | 3300031765 | Soil | QVCGLALTEHGTLAQLRARVLTFGDLKQRSATSFYIVE |
| Ga0318546_112365022 | 3300031771 | Soil | EAAEKVCGLALTANGTLAQLRARVLTFGDLKQRSATSFYAVE |
| Ga0318543_101780851 | 3300031777 | Soil | EAAEKVCGLALTDNGTLAQLRARVLTFGDLKQRSATSFYAVE |
| Ga0318508_10464842 | 3300031780 | Soil | EKVCGLALTENGTLAQLRARVLTFGDLKQRSATSFYAVK |
| Ga0318529_101842031 | 3300031792 | Soil | RKEAAEKVCGLALTANGTLAQLRARVLTFGDLKQRSATSFYAVE |
| Ga0318568_107604011 | 3300031819 | Soil | AAEKVCGLALTEHGTLAQLRARVLTFGDLKQRSATSFYIVD |
| Ga0318499_101026442 | 3300031832 | Soil | GLALTENGTLAQLRARVLTFGDLKHRSATSFYAVK |
| Ga0318517_102546311 | 3300031835 | Soil | GLALTDNGTLAQLRARVLTFGDLKQRSATSFYAVE |
| Ga0318512_102015191 | 3300031846 | Soil | AEKVCGLALTENGTLAQLRARVLTFGDLKQRSATSFYAVK |
| Ga0318495_102877331 | 3300031860 | Soil | AEKVCGLALTEHGTLAQLRARVLTFGDLKQRSATSFYIVE |
| Ga0306925_109043452 | 3300031890 | Soil | AEKVCGLALTDNGTLAQLRARVLTFGDLKQRSATSFYAVE |
| Ga0310900_102775282 | 3300031908 | Soil | ASAKEAAEKVCGRALKQDGKLAQLRARVLTLGDLKQRSATPFYDAD |
| Ga0310916_106786941 | 3300031942 | Soil | EKVCGLALTDNGTLAQLRARVLTFGDLKQRSATSFYAVE |
| Ga0310916_110389612 | 3300031942 | Soil | KEAAEKVCGLALTENGTLAQLRARVLTFGDLKQRSATSFYAVE |
| Ga0310913_100228625 | 3300031945 | Soil | RLAASKEAAEKVCGRTLKEAGKLAQLRARVLTLGDLKQHAATPFYAAD |
| Ga0306926_110743881 | 3300031954 | Soil | LNWRKVEAASAKEAAEKVCGRVLSEAGRHSQLRARVLKFGDLRQRSAMEFYAID |
| Ga0306926_121655422 | 3300031954 | Soil | GFALAQTGRLAQLRARVLRLGDLRQRSATEFYAVE |
| Ga0310906_100903941 | 3300032013 | Soil | WSLEHNWKKVEAASAKEAAEKVCGRALKQDGKLAQLRARVLALGDLKQRSATPFYDAD |
| Ga0310906_103983891 | 3300032013 | Soil | NWKKVEAASAKEAAEKVCGRALKQDGKLAQLRARVLTLGDLKQRSATPFYDAD |
| Ga0318553_102226881 | 3300032068 | Soil | EKVCGLALTANGTLAQLRARVLTFGDLKQRSATSFYAVE |
| Ga0318525_105472572 | 3300032089 | Soil | EKVCGLALTEHGTLAQLRARVLTFGDLKQRSATSFYIVE |
| Ga0318540_104327632 | 3300032094 | Soil | EAAEKVCGLALTEHGTLAQLRARVLTFGDLKQRSATSFYVVK |
| Ga0247830_104470081 | 3300033551 | Soil | AEKVCGRALKQDGKLAQLRARVLTLGDLKQRSATPFYDAE |
| ⦗Top⦘ |