


| Basic Information | |
|---|---|
| Family ID | F105449 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 52 residues |
| Representative Sequence | MTLKCVECGRIALKLNAEKKCEECAKKDESMKSYFTKLFFINEGCARLVPAT |
| Number of Associated Samples | 70 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 85.00 % |
| % of genes near scaffold ends (potentially truncated) | 26.00 % |
| % of genes from short scaffolds (< 2000 bps) | 80.00 % |
| Associated GOLD sequencing projects | 61 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (89.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge (27.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (40.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.38% β-sheet: 9.62% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF10050 | DUF2284 | 7.00 |
| PF12681 | Glyoxalase_2 | 3.00 |
| PF00245 | Alk_phosphatase | 3.00 |
| PF17200 | sCache_2 | 2.00 |
| PF00903 | Glyoxalase | 2.00 |
| PF07690 | MFS_1 | 2.00 |
| PF00108 | Thiolase_N | 1.00 |
| PF03480 | DctP | 1.00 |
| PF02371 | Transposase_20 | 1.00 |
| PF01909 | NTP_transf_2 | 1.00 |
| PF08448 | PAS_4 | 1.00 |
| PF05872 | HerA_C | 1.00 |
| PF05036 | SPOR | 1.00 |
| PF12850 | Metallophos_2 | 1.00 |
| PF08269 | dCache_2 | 1.00 |
| PF00441 | Acyl-CoA_dh_1 | 1.00 |
| PF08447 | PAS_3 | 1.00 |
| PF02254 | TrkA_N | 1.00 |
| PF03793 | PASTA | 1.00 |
| PF00561 | Abhydrolase_1 | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG1785 | Alkaline phosphatase | Inorganic ion transport and metabolism [P] | 3.00 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 1.00 |
| COG0433 | Archaeal DNA helicase HerA or a related bacterial ATPase, contains HAS-barrel and ATPase domains | Replication, recombination and repair [L] | 1.00 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 1.00 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.00 % |
| Unclassified | root | N/A | 8.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000032|Draft_c0010266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2493 | Open in IMG/M |
| 3300000032|Draft_c0084663 | All Organisms → cellular organisms → Bacteria | 3953 | Open in IMG/M |
| 3300001806|JGI20216J20342_1025549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 522 | Open in IMG/M |
| 3300002961|JGI11641J44799_10005978 | Not Available | 3699 | Open in IMG/M |
| 3300003858|Ga0031656_10115920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 961 | Open in IMG/M |
| 3300003858|Ga0031656_10323784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 520 | Open in IMG/M |
| 3300003910|JGI26437J51864_10049091 | Not Available | 904 | Open in IMG/M |
| 3300004155|Ga0066600_10345905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 690 | Open in IMG/M |
| 3300006224|Ga0079037_100068062 | All Organisms → cellular organisms → Bacteria | 2868 | Open in IMG/M |
| 3300006930|Ga0079303_10002660 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4764 | Open in IMG/M |
| 3300006930|Ga0079303_10233182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 745 | Open in IMG/M |
| 3300009053|Ga0105095_10092255 | All Organisms → cellular organisms → Bacteria | 1639 | Open in IMG/M |
| 3300009078|Ga0105106_10173483 | Not Available | 1580 | Open in IMG/M |
| 3300009078|Ga0105106_10677370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 737 | Open in IMG/M |
| 3300009091|Ga0102851_10373639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 1425 | Open in IMG/M |
| 3300009131|Ga0115027_10150400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1423 | Open in IMG/M |
| 3300009166|Ga0105100_10179550 | Not Available | 1259 | Open in IMG/M |
| 3300009587|Ga0115602_1132183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 606 | Open in IMG/M |
| 3300009587|Ga0115602_1247098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 561 | Open in IMG/M |
| 3300009655|Ga0116190_1056906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 1637 | Open in IMG/M |
| 3300009655|Ga0116190_1222113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 635 | Open in IMG/M |
| 3300009655|Ga0116190_1289461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 534 | Open in IMG/M |
| 3300009658|Ga0116188_1019551 | All Organisms → cellular organisms → Bacteria | 3744 | Open in IMG/M |
| 3300009669|Ga0116148_1003070 | All Organisms → cellular organisms → Bacteria | 15733 | Open in IMG/M |
| 3300009673|Ga0116185_1006887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → environmental samples → uncultured beta proteobacterium | 8468 | Open in IMG/M |
| 3300009673|Ga0116185_1236863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 811 | Open in IMG/M |
| 3300009687|Ga0116144_10402569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 685 | Open in IMG/M |
| 3300009687|Ga0116144_10465473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 626 | Open in IMG/M |
| 3300009704|Ga0116145_1006327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → environmental samples → uncultured beta proteobacterium | 8654 | Open in IMG/M |
| 3300009710|Ga0116192_1114783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 916 | Open in IMG/M |
| 3300009771|Ga0116155_10379920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 569 | Open in IMG/M |
| 3300010342|Ga0116252_10126901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1704 | Open in IMG/M |
| 3300010345|Ga0116253_10150401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1587 | Open in IMG/M |
| 3300010356|Ga0116237_10524539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 1034 | Open in IMG/M |
| 3300010429|Ga0116241_10073229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 3056 | Open in IMG/M |
| 3300010429|Ga0116241_10871960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 687 | Open in IMG/M |
| 3300011340|Ga0151652_10350731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 688 | Open in IMG/M |
| 3300011340|Ga0151652_11653546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 697 | Open in IMG/M |
| 3300011340|Ga0151652_12300227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 558 | Open in IMG/M |
| 3300011340|Ga0151652_13020316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 567 | Open in IMG/M |
| 3300014311|Ga0075322_1105683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 661 | Open in IMG/M |
| 3300017974|Ga0187777_10137552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. (in: d-proteobacteria) | 1625 | Open in IMG/M |
| 3300019234|Ga0172288_1003513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 549 | Open in IMG/M |
| 3300019234|Ga0172288_1008916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 634 | Open in IMG/M |
| 3300019234|Ga0172288_1078581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 865 | Open in IMG/M |
| 3300019252|Ga0172286_1160785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 839 | Open in IMG/M |
| 3300022177|Ga0228536_1000321 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 102446 | Open in IMG/M |
| 3300022185|Ga0079039_1468203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 549 | Open in IMG/M |
| 3300025613|Ga0208461_1046629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1452 | Open in IMG/M |
| 3300025629|Ga0208824_1103441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 847 | Open in IMG/M |
| 3300025638|Ga0208198_1016309 | All Organisms → cellular organisms → Bacteria | 3456 | Open in IMG/M |
| 3300025638|Ga0208198_1130633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 696 | Open in IMG/M |
| 3300025708|Ga0209201_1003020 | All Organisms → cellular organisms → Bacteria | 15331 | Open in IMG/M |
| 3300025720|Ga0208197_1018430 | All Organisms → cellular organisms → Bacteria | 3465 | Open in IMG/M |
| 3300025724|Ga0208196_1124227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 877 | Open in IMG/M |
| 3300025740|Ga0208940_1051826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 1719 | Open in IMG/M |
| 3300025859|Ga0209096_1203291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 748 | Open in IMG/M |
| 3300025859|Ga0209096_1263167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 630 | Open in IMG/M |
| 3300025978|Ga0210092_1007157 | Not Available | 1403 | Open in IMG/M |
| 3300026349|Ga0256811_1040724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 518 | Open in IMG/M |
| 3300027675|Ga0209077_1207508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 546 | Open in IMG/M |
| 3300027693|Ga0209704_1056228 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300027713|Ga0209286_1080840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 1214 | Open in IMG/M |
| 3300027885|Ga0209450_10002347 | All Organisms → cellular organisms → Bacteria | 9534 | Open in IMG/M |
| 3300027885|Ga0209450_10564786 | Not Available | 832 | Open in IMG/M |
| 3300027897|Ga0209254_10227826 | Not Available | 1471 | Open in IMG/M |
| 3300027897|Ga0209254_10854675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 610 | Open in IMG/M |
| 3300027899|Ga0209668_11128586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 528 | Open in IMG/M |
| 3300027902|Ga0209048_10262233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 1226 | Open in IMG/M |
| 3300027955|Ga0209078_1073016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 999 | Open in IMG/M |
| 3300027979|Ga0209705_10392488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 692 | Open in IMG/M |
| 3300029252|Ga0167179_1045245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 767 | Open in IMG/M |
| 3300032156|Ga0315295_10824178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 930 | Open in IMG/M |
| 3300032397|Ga0315287_10050124 | All Organisms → cellular organisms → Bacteria | 4588 | Open in IMG/M |
| 3300033406|Ga0316604_10699907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 557 | Open in IMG/M |
| 3300033413|Ga0316603_10378353 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Hymenobacteraceae → Pontibacter → unclassified Pontibacter → Pontibacter sp. SGAir0037 | 1274 | Open in IMG/M |
| 3300033413|Ga0316603_10898855 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → unclassified Halobacteria → Halobacteria archaeon | 834 | Open in IMG/M |
| 3300033414|Ga0316619_10016081 | All Organisms → cellular organisms → Bacteria | 3353 | Open in IMG/M |
| 3300033414|Ga0316619_10359442 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → unclassified Halobacteria → Halobacteria archaeon | 1137 | Open in IMG/M |
| 3300033414|Ga0316619_10701219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 854 | Open in IMG/M |
| 3300033414|Ga0316619_11418578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 620 | Open in IMG/M |
| 3300033416|Ga0316622_100566762 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
| 3300033418|Ga0316625_100262066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae | 1197 | Open in IMG/M |
| 3300033418|Ga0316625_100928244 | Not Available | 765 | Open in IMG/M |
| 3300033433|Ga0326726_10002593 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 16568 | Open in IMG/M |
| 3300033434|Ga0316613_10579669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 765 | Open in IMG/M |
| 3300033434|Ga0316613_11262453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 509 | Open in IMG/M |
| 3300033480|Ga0316620_10052534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae | 2798 | Open in IMG/M |
| 3300033480|Ga0316620_11259332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 726 | Open in IMG/M |
| 3300033482|Ga0316627_101325415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 719 | Open in IMG/M |
| 3300033483|Ga0316629_10197441 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| 3300033483|Ga0316629_10518015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae | 870 | Open in IMG/M |
| 3300033483|Ga0316629_11525716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 545 | Open in IMG/M |
| 3300033487|Ga0316630_10577713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 934 | Open in IMG/M |
| 3300033488|Ga0316621_10674054 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → unclassified Halobacteria → Halobacteria archaeon | 744 | Open in IMG/M |
| 3300033488|Ga0316621_11134483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 588 | Open in IMG/M |
| 3300033513|Ga0316628_100042315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4631 | Open in IMG/M |
| 3300033513|Ga0316628_102737932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 649 | Open in IMG/M |
| 3300033521|Ga0316616_103484506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 592 | Open in IMG/M |
| 3300034128|Ga0370490_0235704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 603 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 27.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 24.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 9.00% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 9.00% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 7.00% |
| Wetland | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland | 5.00% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 3.00% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.00% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.00% |
| Hydrocarbon Resource Environments | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Hydrocarbon Resource Environments | 2.00% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 1.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 1.00% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.00% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 1.00% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.00% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.00% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.00% |
| Biosolids | Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Biosolids | 1.00% |
| Defined Medium | Engineered → Modeled → Simulated Communities (Microbial Mixture) → Unclassified → Unclassified → Defined Medium | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000032 | Oil sands microbial community from Northern Alberta which degrade Naphthaline | Engineered | Open in IMG/M |
| 3300001806 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 Bulk Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300002961 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300003858 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI | Environmental | Open in IMG/M |
| 3300003910 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW | Environmental | Open in IMG/M |
| 3300004155 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009587 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009655 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR4_MetaG | Engineered | Open in IMG/M |
| 3300009658 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR2_MetaG | Engineered | Open in IMG/M |
| 3300009669 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG | Engineered | Open in IMG/M |
| 3300009673 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA7_MetaG | Engineered | Open in IMG/M |
| 3300009687 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaG | Engineered | Open in IMG/M |
| 3300009704 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG1_MetaG | Engineered | Open in IMG/M |
| 3300009710 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC113_MetaG | Engineered | Open in IMG/M |
| 3300009771 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC032_MetaG | Engineered | Open in IMG/M |
| 3300010342 | AD_JPNAca1 | Engineered | Open in IMG/M |
| 3300010345 | AD_JPNAca2 | Engineered | Open in IMG/M |
| 3300010356 | AD_USDEca | Engineered | Open in IMG/M |
| 3300010429 | AD_USRAca | Engineered | Open in IMG/M |
| 3300011340 | Combined Assembly of Wetland Metatranscriptomes | Environmental | Open in IMG/M |
| 3300014311 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300019234 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_deep_8_15_core_3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019252 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_deep_8_15_core_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022177 | Enriched culture of PCE-dechlorinating microbial communities from Ithaca, New York, USA - SJ1.S | Engineered | Open in IMG/M |
| 3300022185 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025613 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR4_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025629 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR3_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025638 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR2_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025708 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025720 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA4_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025724 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA7_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025740 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA6_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025859 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC034_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025978 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026349 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PU6 | Environmental | Open in IMG/M |
| 3300027675 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027713 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
| 3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300027955 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027979 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300029252 | Biosolids microbial communities from sewage treatment plant in Sweden - SWESTP26 - Henriksdal-digested 138 | Engineered | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300033406 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CT | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033434 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
| 3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300034128 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Draft_00102662 | 3300000032 | Hydrocarbon Resource Environments | MTLKCVECGRIALKLNAQKKCEECAKKDESMKSYFTKLFFINEGCARLVPAT* |
| Draft_00846632 | 3300000032 | Hydrocarbon Resource Environments | MTLKCAECGRIALKLNAEKKCEECAKKDESLKSYFTKLFFINEGCARLVPAT* |
| JGI20216J20342_10255492 | 3300001806 | Wetland | MTLKCVECGRIALKLNAEKKCEECAKKDESMKSYFTKLFFINEGCARLVPAT* |
| JGI11641J44799_100059782 | 3300002961 | Wetland | MTLKCAECGRIALKLNAEKKCEECAKKDESIKSYFTKLFFINEGCARLVPAT* |
| Ga0031656_101159201 | 3300003858 | Freshwater Lake Sediment | MTLKCAECGRIALKLNAEKKCEECAKKDESIKTYFTKLFFINEGCARLVPAT* |
| Ga0031656_103237841 | 3300003858 | Freshwater Lake Sediment | MTVTCVECGRIVSKLNTERKCEECAKKDESMKSYFTKLFFINPGCARLVPVT* |
| JGI26437J51864_100490913 | 3300003910 | Freshwater Lake Sediment | MTLKCVECGRIALKLNAEKKCEECAKKDESIKSYFTKLFFINEGCARLVPAT* |
| Ga0066600_103459051 | 3300004155 | Freshwater | MTLTCVECGRLVSKLNNEKKCEECAKKDESMKSYFTKLFFINPGCARLVPVT* |
| Ga0079037_1000680623 | 3300006224 | Freshwater Wetlands | MTLKCAECGRISLKLNAEKKCEECAKKDESMKSYFTKLFFINEGCARLVPAT* |
| Ga0079303_100026603 | 3300006930 | Deep Subsurface | MTFKCVECGRIVLKLNAEKKCEECARKDESMKSYFTKLFFINEGCARLVPAT* |
| Ga0079303_102331822 | 3300006930 | Deep Subsurface | MTLKCVECGRIALKLNAEKKCEECAKKDESMKSYFTRLFFINEGCARLVPAT* |
| Ga0105095_100922553 | 3300009053 | Freshwater Sediment | MTFKCVECGRIALKLNTEKKCEECAKKDESMKSYFTKLFFINEGCARLVPAT* |
| Ga0105106_101734834 | 3300009078 | Freshwater Sediment | MTLKCAECGRIALKLNAEKKCEECAKKDESMKSYFTKLFFINEGCARLVPAT* |
| Ga0105106_106773701 | 3300009078 | Freshwater Sediment | MTLKCVECGRISFKLNAEKKCAECAKKDEMKDESMKSCFGKLVFINENYARLVPRD* |
| Ga0102851_103736394 | 3300009091 | Freshwater Wetlands | MTLKCAECGRISLKLNADKKCEECAKKDESMKSYFTKLFFINEGCARLVPAT* |
| Ga0115027_101504003 | 3300009131 | Wetland | MTFQCVECGRIVLKLNAEKKCEECARKDESMKSYFTKLFFINEGCARLVPAT* |
| Ga0105100_101795504 | 3300009166 | Freshwater Sediment | MTLKCAECGRIAWKLNAEKKCEECAKKDESIKSYFTKLFFINEGCARLVPAT* |
| Ga0115602_11321831 | 3300009587 | Wetland | GINLLAVTSPRRARGGVAMTFKCVECGRIVLKLNAEKKCEECARKDESMKSYFTKLFFINEGCARLVPAT* |
| Ga0115602_12470982 | 3300009587 | Wetland | MTLKCAECGRISLKLNAEKKCEECAKKDESMKSYFTKLFFINDGCARLVPAT* |
| Ga0116190_10569062 | 3300009655 | Anaerobic Digestor Sludge | MTLKCVECGKITLKLNAQNKCEECARKEESLKSYFTKLLFVNESCARLVPAT* |
| Ga0116190_12221131 | 3300009655 | Anaerobic Digestor Sludge | MTWKCVECGKFTLKLNAQNKCEECARKDESLKSYFTRLLFINEGCARLVPAT* |
| Ga0116190_12894612 | 3300009655 | Anaerobic Digestor Sludge | MTLKCAECGKISLKLNAQNKCEECARKDESLKSYFTKLFFINEGCARLVPAT* |
| Ga0116188_10195511 | 3300009658 | Anaerobic Digestor Sludge | MTLKCVECGKITLKLNARNKCEECARKEESMKSYFAKLFFINEGCARLVPAT* |
| Ga0116148_10030702 | 3300009669 | Anaerobic Digestor Sludge | MTWKCVECGKFTLKLNAENKCEECARKDESLKSYFTRLLFINEGCARLVPAA* |
| Ga0116185_10068872 | 3300009673 | Anaerobic Digestor Sludge | MTWKCVECGKFTLKLNAENKCEECARKDESLKSYFTRLLFINEGCARLVPAT* |
| Ga0116185_12368631 | 3300009673 | Anaerobic Digestor Sludge | GTGPRRARGGVAMTLKCVECGKITLKLNARNKCEECARKEESMKSYFAKLFFINEGCARLVPAT* |
| Ga0116144_104025692 | 3300009687 | Anaerobic Digestor Sludge | MTVKCVECGKTVSKVNARNRCEECAKKEESMKAYFTRLFFINDSCARLVPAT* |
| Ga0116144_104654732 | 3300009687 | Anaerobic Digestor Sludge | MTWKCVECGKFTLKLNAENKCEECARKDESLKSYFTRLLFINEGCARLVPA |
| Ga0116145_10063272 | 3300009704 | Anaerobic Digestor Sludge | MTLKCVECGKITLKLNAQNKCEECARKEESLKSYFTRLLFVNESCARLVPAT* |
| Ga0116192_11147833 | 3300009710 | Anaerobic Digestor Sludge | MTLKCAECGKISLKLNAQNKCEGCARKDEPLKSYFTKLFFINEGCARLVPAT* |
| Ga0116155_103799202 | 3300009771 | Anaerobic Digestor Sludge | MAVKCVECGKTVLKVNAKNKCEECARKDESMKSYFTRLFFINESCARLVPAT* |
| Ga0116252_101269012 | 3300010342 | Anaerobic Digestor Sludge | MTLKCAECGKISLKLNAQNKCEGCARKDESLKSYFTKLFFINEGCARLVPAT* |
| Ga0116253_101504011 | 3300010345 | Anaerobic Digestor Sludge | MTLKCAECGKISLKLNAQNKCEGCARKDESLKSYFTKLFFINEGCARLVLAT* |
| Ga0116237_105245392 | 3300010356 | Anaerobic Digestor Sludge | MTLKCVECGKLALKLNAEKKCEECARKDESLKSYFTRLFFINESCARLVPAT* |
| Ga0116241_100732292 | 3300010429 | Anaerobic Digestor Sludge | MTLKCVECGRITLKLNAENKCEECARKDESLKSYFTRLFFINESCARLVPAA* |
| Ga0116241_108719602 | 3300010429 | Anaerobic Digestor Sludge | MAEKCVDCGKMVPKLNARNKCEECARKDESLKSYFTRLFFINEGCARLVPAT* |
| Ga0151652_103507312 | 3300011340 | Wetland | MTLKCVECGRIALKLNAEKKCEECAKKEESVKSYFTKLFFINEGCARLVPAT* |
| Ga0151652_116535462 | 3300011340 | Wetland | MTLTCVKCGRLVSKLNTEKKCEECAKKDESMKSYFTKLFFINPGCARLVPVN* |
| Ga0151652_123002272 | 3300011340 | Wetland | MAVKCVECGKTVLKVNARNKCEECARKDESLKSYFTRLFFINEGCARLVPAT* |
| Ga0151652_130203161 | 3300011340 | Wetland | GGVVMTLKCVECGRIALKLNAEKKCEECAKKDESMKSYFTKLFFINEGCARLVPAT* |
| Ga0075322_11056832 | 3300014311 | Natural And Restored Wetlands | LKCVEYGRIALKLNAQKKCEECAKKDESVKSYFTKLFFINEGCARLVPAT* |
| Ga0187777_101375523 | 3300017974 | Tropical Peatland | MTLKCVECGRITLKLNAENKCEECAKKDESMKSYFTKLAFINESCAKLVPAT |
| Ga0172288_10035131 | 3300019234 | Wetland | MTFKCVECGRIVLKLNAEKKCEECARKDESMKSYFTKLFFINEGCARLVPAT |
| Ga0172288_10089162 | 3300019234 | Wetland | MTLKCVECGRIALKLNAEKKCEECAKKDESMKSYFTRLFFINEGCARLVPAT |
| Ga0172288_10785811 | 3300019234 | Wetland | MTLKCVECGKISLKLNAEKKCEVCARKDESLKSYFTKLLFINEGCARLVPAT |
| Ga0172286_11607852 | 3300019252 | Wetland | MTLKCVECGRITLKLNAEKKCEVCARKDESLKSYFTKLLFINEGCARLVPAT |
| Ga0228536_100032112 | 3300022177 | Defined Medium | MAVKCVECGKTVLKVNAKNKCEECARKDESMKSYFTRLFFINESCARLVPAT |
| Ga0079039_14682032 | 3300022185 | Freshwater Wetlands | MTLKCAECGRISLKLNAEKKCEECAKKDESMKSYFTKLFFINEGCARLVPAT |
| Ga0208461_10466293 | 3300025613 | Anaerobic Digestor Sludge | MTWKCVECGKFTLKLNAQNKCEECARKDESLKSYFTKLFFINEGCARLVPAT |
| Ga0208824_11034412 | 3300025629 | Anaerobic Digestor Sludge | MTLKCVECGKITLKLNAQNKCEECARKEESLKSYFTKLLFVNESCARLVPAT |
| Ga0208198_10163091 | 3300025638 | Anaerobic Digestor Sludge | VECGKITLKLNAQNKCEECARKEESLKSYFTKLLFVNESCARLVPAT |
| Ga0208198_11306331 | 3300025638 | Anaerobic Digestor Sludge | MTLKCVECGKITLKLNARNKCEECARKEESMKSYFAKLFFINEGCARLVPAT |
| Ga0209201_100302014 | 3300025708 | Anaerobic Digestor Sludge | MTWKCVECGKFTLKLNAENKCEECARKDESLKSYFTRLLFINEGCARLVPAA |
| Ga0208197_10184301 | 3300025720 | Anaerobic Digestor Sludge | GKISLKLNAQNKCEECARKDESLKSYFTKLFFINEGCARLVPAT |
| Ga0208196_11242272 | 3300025724 | Anaerobic Digestor Sludge | MTLKCAECGKISLKLNAQNKCEGCARKDESLKSYFTKLFFINEGCARLVPAT |
| Ga0208940_10518263 | 3300025740 | Anaerobic Digestor Sludge | MTLKCAECGKISLKLNAQNKCEGCARKDESLKSYFTKLFFINEGCARLVLAT |
| Ga0209096_12032911 | 3300025859 | Anaerobic Digestor Sludge | MTVKCVECGKTVSKVNARNRCEECAKKEESMKAYFTRLFFINDSCARLVPAT |
| Ga0209096_12631672 | 3300025859 | Anaerobic Digestor Sludge | MTWKCVECGKFTLKLNAENKCEECARKDESLKSYFTRLLFINEGC |
| Ga0210092_10071572 | 3300025978 | Natural And Restored Wetlands | MTLKCAECGRIALKLNAEKKCEECAKKDESIKSYFTKLFFINEGCARLVPAT |
| Ga0256811_10407241 | 3300026349 | Sediment | MTLTCVECGRITLKLNAQKKCEECAKKDESMKSYFTKLFFINEGCARLVPAT |
| Ga0209077_12075081 | 3300027675 | Freshwater Sediment | GTLPRRDRGGVAMTFKCVECGRIALKLNTEKKCEECAKKDESMKSYFTKLFFINEGCARLVPAT |
| Ga0209704_10562281 | 3300027693 | Freshwater Sediment | AMTFKCVECGRIVLKLNAEKKCEECAKKDESMKSYFTKLFFINEGCARLVPAT |
| Ga0209286_10808403 | 3300027713 | Freshwater Sediment | MTFKCVECGRIALKLNTEKKCEECAKKDESMKSYFTKLFFINEGCARLVPAT |
| Ga0209450_100023476 | 3300027885 | Freshwater Lake Sediment | MTLKCVECGRIALKLNAEKKCEECAKKDESIKSYFTKLFFINEGCARLVPAT |
| Ga0209450_105647863 | 3300027885 | Freshwater Lake Sediment | MTLKCAECGRIALKLNAEKKCEECAKKDESIKSYFTKLFFINEGCARL |
| Ga0209254_102278263 | 3300027897 | Freshwater Lake Sediment | MTLKCAECGRIALKLNAEKKCEECAKKDESIKTYFTKLFFINEGCARLVPAT |
| Ga0209254_108546752 | 3300027897 | Freshwater Lake Sediment | MTLKCVECGRIALKLNAEKKCEECAKKDESTKSYFTKLFFINEGCARLVPAT |
| Ga0209668_111285861 | 3300027899 | Freshwater Lake Sediment | RGGVAMTLKCVECGRIALKLNAEKKCEECAKKDESMKSYFTKLFFINEGCARLVPAT |
| Ga0209048_102622331 | 3300027902 | Freshwater Lake Sediment | MTLKCVECGRIALKLTAEKKCKECAKKEESMKSYFTKLFFINKGCARLVPAT |
| Ga0209078_10730161 | 3300027955 | Freshwater Sediment | MTFKCVECGRIALKLNTEKKCEECAKKDESMKSYFTKLFFINEGCARL |
| Ga0209705_103924881 | 3300027979 | Freshwater Sediment | MTLKCVECGRISFKLNAEKKCAECAKKDEMKDESMKSCFGKLVFINENYARLVPRD |
| Ga0167179_10452451 | 3300029252 | Biosolids | MTLRCVECGKISLKLNAQNKCEECARKDESLKSYFTKLFFINEGCAXXXVPAT |
| Ga0315295_108241781 | 3300032156 | Sediment | MTLKCVECGRIALKLNAEKKCEECAKKDESMKSYFTKLFFINEGCARLVPAT |
| Ga0315287_100501244 | 3300032397 | Sediment | MTLTCVECGRLVSKLNTEKKCEECAKKDESMKSYFTKLFFINPGCARLVPVN |
| Ga0316604_106999071 | 3300033406 | Soil | MTLKCVECGKITLKLNAENKCEQCARKDEPMKSYFTKLFFSNASCAKLVPVN |
| Ga0316603_103783532 | 3300033413 | Soil | MTLKCVECGRIALKLNAQKKCEECAKKDESMKSYFTKLFFINEGCARLVPAT |
| Ga0316603_108988551 | 3300033413 | Soil | MTLKCVECGRIALKLNAEKKCGECAKKDESIKSYFTKLFFINEGCARLVPAT |
| Ga0316619_100160815 | 3300033414 | Soil | MTLKCAECGRISLKLNAEKKCEECAKKDESMKSYFTKLFFINEGCAR |
| Ga0316619_103594421 | 3300033414 | Soil | AECGRISLKLNAEKKCEECAKKDESMKSYFTKLFFINEGCARLVPAT |
| Ga0316619_107012191 | 3300033414 | Soil | MTLKCVECGRIALKLNAEKKCEECAKKDESMKSYFTKLFFINEGCARL |
| Ga0316619_114185781 | 3300033414 | Soil | MTFKCVECGRIVLKLNAGKKCVECAKKEESMKSYFTKLFFINEG |
| Ga0316622_1005667623 | 3300033416 | Soil | FKCVECGRIVLKLNAEKKCEECARKDESMKSYFTKLFFINEGCARLVPAT |
| Ga0316625_1002620661 | 3300033418 | Soil | CGRMVLKLNTEKKCEECAKKDESMKSYFTKLFFINEGCARLVPAT |
| Ga0316625_1009282441 | 3300033418 | Soil | MTLKCVECGRIALKLNDEKKCGECAKKDESIKSYFTKLFFINEGCARLVPAT |
| Ga0326726_1000259317 | 3300033433 | Peat Soil | MTLTCVECGRIVSKLNDEKKCEECAKKGESMKSYFTKLFFINASCARLVPAT |
| Ga0316613_105796691 | 3300033434 | Soil | MTLKCVECGKITLKLNAENKCEQCARKDEPMKSYFTKLFFSNASCAKL |
| Ga0316613_112624532 | 3300033434 | Soil | MTFKCVECGRMVLKLNTEKKCEECAKKDESMKSYFTKLFFINEGCARLVPAT |
| Ga0316620_100525341 | 3300033480 | Soil | MTFKCVECGRMVLKLNTEKKCDECAKKDESMKSYFTKLFFINEGCARLVPAT |
| Ga0316620_112593322 | 3300033480 | Soil | GTLPWRAGGGVAMTFKCVECGRIVLKLNTEKKCEECAKKDESMKSYFTKLFFINKGCARLVPAS |
| Ga0316627_1013254152 | 3300033482 | Soil | WRARGGVDMTFKCVECGRMVLKLNTEKKCEACAKKDESMKSYFTKLFFINEGCARLVPAT |
| Ga0316629_101974413 | 3300033483 | Soil | KCVECGRIVLKLNAEKKCEECARKDESMKSYFTKLFFINEGCARLVPAT |
| Ga0316629_105180152 | 3300033483 | Soil | AQGGVAMTFKCVECGRMVLKLNTEKKCEECAKKDESMKSYFTKLFFINEGCARLVPAT |
| Ga0316629_115257161 | 3300033483 | Soil | MTFKCVECGRIVLKLNAGKKCVECAKKEESMKSYFTKLFFINEGC |
| Ga0316630_105777132 | 3300033487 | Soil | MTFKCVECGRIVLKLNTEKKCEECAKKDESMKSYFTKLFFINKGCARLVPAS |
| Ga0316621_106740541 | 3300033488 | Soil | MTLKCVECGRIALKLNAEKKCEECAKKDESIKSYFTKLFFINEG |
| Ga0316621_111344831 | 3300033488 | Soil | MTLKCAECGRIALKLNAEKKCEECAKKDESMKSYFTKLFFINEGCARLVPAT |
| Ga0316628_1000423153 | 3300033513 | Soil | LPRRAGGGVAMTFKCVECGRMVLKLNTEKKCEECAKKDESMKSYFTKLFFINEGCARLVPAT |
| Ga0316628_1027379321 | 3300033513 | Soil | MPWRAQGGVAMTFKCVECGRMVLKLNTEKKCDECAKKDESMKSYFTKLFFINEGCARLVPAT |
| Ga0316616_1034845063 | 3300033521 | Soil | MTFKCVECGRMVLKLNTEKKCEACAKKDESMKSYFTKLFFINEG |
| Ga0370490_0235704_43_201 | 3300034128 | Untreated Peat Soil | MTLKCAECGRISLKLNAEKKCEECAKKDESMKSYFTKLFFINPGCARLVPVN |
| ⦗Top⦘ |