


| Basic Information | |
|---|---|
| Family ID | F105439 |
| Family Type | Metagenome |
| Number of Sequences | 100 |
| Average Sequence Length | 42 residues |
| Representative Sequence | GIEVGAYYTGNNAKSAFYTDLTNYNTAKDRGVVYVKKTF |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.00 % |
| % of genes near scaffold ends (potentially truncated) | 91.00 % |
| % of genes from short scaffolds (< 2000 bps) | 93.00 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.25 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (8.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (33.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.48% β-sheet: 23.88% Coil/Unstructured: 71.64% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF00543 | P-II | 70.00 |
| PF00909 | Ammonium_transp | 17.00 |
| PF09604 | Potass_KdpF | 2.00 |
| PF03193 | RsgA_GTPase | 1.00 |
| PF09694 | Gcw_chp | 1.00 |
| PF00359 | PTS_EIIA_2 | 1.00 |
| PF03951 | Gln-synt_N | 1.00 |
| PF03814 | KdpA | 1.00 |
| PF04339 | FemAB_like | 1.00 |
| PF00378 | ECH_1 | 1.00 |
| PF04380 | BMFP | 1.00 |
| PF00589 | Phage_integrase | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0347 | Nitrogen regulatory protein PII | Signal transduction mechanisms [T] | 70.00 |
| COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 17.00 |
| COG0174 | Glutamine synthetase | Amino acid transport and metabolism [E] | 1.00 |
| COG1162 | Ribosome biogenesis GTPase RsgA | Translation, ribosomal structure and biogenesis [J] | 1.00 |
| COG2060 | K+-transporting ATPase, KdpA subunit | Inorganic ion transport and metabolism [P] | 1.00 |
| COG2960 | Ubiquinone biosynthesis accessory factor UbiK | Coenzyme transport and metabolism [H] | 1.00 |
| COG3146 | Predicted N-acyltransferase | General function prediction only [R] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.00 % |
| Unclassified | root | N/A | 13.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000953|JGI11615J12901_11600949 | Not Available | 553 | Open in IMG/M |
| 3300000955|JGI1027J12803_108412950 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 589 | Open in IMG/M |
| 3300003858|Ga0031656_10203801 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 678 | Open in IMG/M |
| 3300004114|Ga0062593_102357071 | Not Available | 600 | Open in IMG/M |
| 3300004282|Ga0066599_100796073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 663 | Open in IMG/M |
| 3300004633|Ga0066395_10541550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 676 | Open in IMG/M |
| 3300005176|Ga0066679_11037584 | Not Available | 509 | Open in IMG/M |
| 3300005339|Ga0070660_100438374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1083 | Open in IMG/M |
| 3300005355|Ga0070671_100973775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 743 | Open in IMG/M |
| 3300005355|Ga0070671_102017744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 513 | Open in IMG/M |
| 3300005507|Ga0074259_10734756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 546 | Open in IMG/M |
| 3300005586|Ga0066691_10802202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 555 | Open in IMG/M |
| 3300005617|Ga0068859_101744214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 688 | Open in IMG/M |
| 3300005618|Ga0068864_101556572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 665 | Open in IMG/M |
| 3300005719|Ga0068861_100527631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1072 | Open in IMG/M |
| 3300005834|Ga0068851_10270034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 969 | Open in IMG/M |
| 3300005842|Ga0068858_100779063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 933 | Open in IMG/M |
| 3300005843|Ga0068860_101294327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 750 | Open in IMG/M |
| 3300006046|Ga0066652_101341111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 673 | Open in IMG/M |
| 3300006057|Ga0075026_100566878 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300006224|Ga0079037_101014323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 821 | Open in IMG/M |
| 3300006224|Ga0079037_101487408 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 676 | Open in IMG/M |
| 3300006755|Ga0079222_11009627 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 716 | Open in IMG/M |
| 3300006806|Ga0079220_12102084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 506 | Open in IMG/M |
| 3300006844|Ga0075428_100821362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 988 | Open in IMG/M |
| 3300006876|Ga0079217_10356249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 841 | Open in IMG/M |
| 3300009075|Ga0105090_10003395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 9043 | Open in IMG/M |
| 3300009157|Ga0105092_10818711 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300009167|Ga0113563_11043926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Desulfosporosinus → Candidatus Desulfosporosinus infrequens | 943 | Open in IMG/M |
| 3300009176|Ga0105242_11983971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b | 624 | Open in IMG/M |
| 3300009179|Ga0115028_11203557 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300009545|Ga0105237_11394689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 707 | Open in IMG/M |
| 3300009664|Ga0116146_1365220 | Not Available | 536 | Open in IMG/M |
| 3300009840|Ga0126313_11065211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Hydrogenophilalia → Hydrogenophilales | 664 | Open in IMG/M |
| 3300010320|Ga0134109_10296046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Hydrogenophilalia → Hydrogenophilales | 622 | Open in IMG/M |
| 3300010326|Ga0134065_10248926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Hydrogenophilalia → Hydrogenophilales | 662 | Open in IMG/M |
| 3300012203|Ga0137399_11025244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Hydrogenophilalia → Hydrogenophilales | 695 | Open in IMG/M |
| 3300012684|Ga0136614_10447537 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 938 | Open in IMG/M |
| 3300012904|Ga0157282_10068813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 917 | Open in IMG/M |
| 3300014266|Ga0075359_1106685 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300014305|Ga0075349_1060047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 789 | Open in IMG/M |
| 3300014884|Ga0180104_1257176 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300015255|Ga0180077_1131750 | Not Available | 528 | Open in IMG/M |
| 3300015371|Ga0132258_10117791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 6304 | Open in IMG/M |
| 3300015374|Ga0132255_100792018 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1413 | Open in IMG/M |
| 3300015374|Ga0132255_103633476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b | 656 | Open in IMG/M |
| 3300015374|Ga0132255_104571976 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300015374|Ga0132255_104948308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Hydrogenophilalia → Hydrogenophilales | 564 | Open in IMG/M |
| 3300018000|Ga0184604_10302450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Hydrogenophilalia → Hydrogenophilales | 565 | Open in IMG/M |
| 3300018422|Ga0190265_13312994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Hydrogenophilalia → Hydrogenophilales | 537 | Open in IMG/M |
| 3300018431|Ga0066655_10235477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1158 | Open in IMG/M |
| 3300021073|Ga0210378_10092539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1180 | Open in IMG/M |
| 3300021081|Ga0210379_10390072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Hydrogenophilalia → Hydrogenophilales | 614 | Open in IMG/M |
| 3300021344|Ga0193719_10173641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 926 | Open in IMG/M |
| 3300021559|Ga0210409_11307729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Hydrogenophilalia → Hydrogenophilales | 601 | Open in IMG/M |
| 3300023071|Ga0247752_1073765 | Not Available | 561 | Open in IMG/M |
| 3300025321|Ga0207656_10049287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1816 | Open in IMG/M |
| 3300025912|Ga0207707_10527477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1005 | Open in IMG/M |
| 3300025923|Ga0207681_10202484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1525 | Open in IMG/M |
| 3300025923|Ga0207681_11451827 | Not Available | 575 | Open in IMG/M |
| 3300025932|Ga0207690_10528872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 956 | Open in IMG/M |
| 3300025940|Ga0207691_10908514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 737 | Open in IMG/M |
| 3300025941|Ga0207711_10344131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1380 | Open in IMG/M |
| 3300025956|Ga0210104_1035385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 612 | Open in IMG/M |
| 3300025972|Ga0207668_10592292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 965 | Open in IMG/M |
| 3300025993|Ga0208415_1018248 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300026041|Ga0207639_10018117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4999 | Open in IMG/M |
| 3300026067|Ga0207678_10109559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2355 | Open in IMG/M |
| 3300026088|Ga0207641_12319406 | Not Available | 536 | Open in IMG/M |
| 3300026837|Ga0209856_1003426 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 749 | Open in IMG/M |
| 3300027843|Ga0209798_10304269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 763 | Open in IMG/M |
| 3300027915|Ga0209069_10149705 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1160 | Open in IMG/M |
| 3300027975|Ga0209391_10031832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2608 | Open in IMG/M |
| 3300027975|Ga0209391_10145686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1016 | Open in IMG/M |
| 3300028381|Ga0268264_10137352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2175 | Open in IMG/M |
| 3300028381|Ga0268264_10789301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 948 | Open in IMG/M |
| 3300028870|Ga0302254_10053901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1450 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10153999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Hydrogenophilalia → Hydrogenophilales | 632 | Open in IMG/M |
| 3300031548|Ga0307408_102452568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b | 507 | Open in IMG/M |
| 3300031720|Ga0307469_10641813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 955 | Open in IMG/M |
| 3300031852|Ga0307410_10152500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1722 | Open in IMG/M |
| 3300031852|Ga0307410_11833916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Hydrogenophilalia → Hydrogenophilales | 539 | Open in IMG/M |
| 3300031890|Ga0306925_10271493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1827 | Open in IMG/M |
| 3300032039|Ga0318559_10591310 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 518 | Open in IMG/M |
| 3300032066|Ga0318514_10800546 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
| 3300032126|Ga0307415_101264596 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 698 | Open in IMG/M |
| 3300032163|Ga0315281_12041725 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300032164|Ga0315283_11629424 | Not Available | 656 | Open in IMG/M |
| 3300032164|Ga0315283_11899200 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 596 | Open in IMG/M |
| 3300032180|Ga0307471_102312877 | Not Available | 678 | Open in IMG/M |
| 3300032397|Ga0315287_11107620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 916 | Open in IMG/M |
| 3300032516|Ga0315273_11373181 | Not Available | 877 | Open in IMG/M |
| 3300033408|Ga0316605_11150005 | Not Available | 749 | Open in IMG/M |
| 3300033412|Ga0310810_11114819 | Not Available | 654 | Open in IMG/M |
| 3300033413|Ga0316603_10241668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax | 1564 | Open in IMG/M |
| 3300033413|Ga0316603_12304996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 507 | Open in IMG/M |
| 3300033418|Ga0316625_101491899 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300033433|Ga0326726_12110165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 548 | Open in IMG/M |
| 3300033488|Ga0316621_10676722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 743 | Open in IMG/M |
| 3300034354|Ga0364943_0017225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 2203 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 8.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 6.00% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.00% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 4.00% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 3.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.00% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.00% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.00% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.00% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.00% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.00% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.00% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 1.00% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.00% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.00% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.00% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.00% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 1.00% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 1.00% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.00% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.00% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003858 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005507 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 | Host-Associated | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009664 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG2_MetaG | Engineered | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
| 3300012904 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1 | Environmental | Open in IMG/M |
| 3300014266 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014305 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014884 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da | Environmental | Open in IMG/M |
| 3300015255 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT466_16_10D | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300023071 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5 | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025956 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025993 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 (SPAdes) | Environmental | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026837 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_25-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027975 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028870 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_4 | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11615J12901_116009492 | 3300000953 | Soil | ELGAYYTGNNAKSLPYTDLNNYDTSKDRGVFYVKKTF* |
| JGI1027J12803_1084129502 | 3300000955 | Soil | GVSYTVPEGFFKNFELGAYYTGSDAKSRFYTDLTGRDTSKDRGIVYVKKTF* |
| Ga0031656_102038011 | 3300003858 | Freshwater Lake Sediment | VPDGTMKGLEFGAYYTGTTAERPFYTDLTGYDTGRDRGVIYVKKTF* |
| Ga0062593_1023570712 | 3300004114 | Soil | GVLKGLELGAYYTGNNAKSLPYTDLTNYDTSKDRGVFYVKKTF* |
| Ga0066599_1007960731 | 3300004282 | Freshwater | VKGLEVGAYYSGNNANTAFYTDLTGYKTAKDVGVLYVKKTF* |
| Ga0066395_105415501 | 3300004633 | Tropical Forest Soil | APDGFFKNFEVGAYYTGSDAKSRFYTDLTGRDTSKDRGVIYVKKTF* |
| Ga0066679_110375842 | 3300005176 | Soil | WKAGVSYTVPEGLFKNIELGAYYTGNNATSFFYTDLTGLDTARSRGVAYVKKTF* |
| Ga0070660_1004383741 | 3300005339 | Corn Rhizosphere | VPDGTFLKGLEVGAYYTDNNAKDTFYTDLTGYDTAKARGVVYVKKTF* |
| Ga0070671_1009737751 | 3300005355 | Switchgrass Rhizosphere | DGTFLKGLEVGAYYTDNNAKEPFYTDLTGYDTAKARGVVYVKKTF* |
| Ga0070671_1020177442 | 3300005355 | Switchgrass Rhizosphere | PVKGLELGAYYTDNNAKEAFYTDLTGYDTSKARGVVYVKKTF* |
| Ga0074259_107347562 | 3300005507 | Arabidopsis Rhizosphere | VPDGVLKGLEVGAYYTGNDSDSKFWTDVTGYDTAKDRGVLYVKKTF* |
| Ga0066691_108022022 | 3300005586 | Soil | EGLFKSVELGAYYTDSNAKQRFYTDLTGYDTTKARGVVYVKKTF* |
| Ga0068859_1017442143 | 3300005617 | Switchgrass Rhizosphere | GAYYTGNNATTPFYTDLTGYNTAKDRGVVYVKKTF* |
| Ga0068864_1015565723 | 3300005618 | Switchgrass Rhizosphere | GIEFGAYYTGNNATTPFYTDLTGYNTAKDRGVVYVKKTF* |
| Ga0068861_1005276311 | 3300005719 | Switchgrass Rhizosphere | EIGAYYSGNNAESAPYTDLTGYDTSKDRGVIYVKKTF* |
| Ga0068851_102700343 | 3300005834 | Corn Rhizosphere | ELGAYYTDNNAKEAFYTDLTGYDTSKARGVVYVKKTF* |
| Ga0068858_1007790631 | 3300005842 | Switchgrass Rhizosphere | AYYSGNDAKKAFYTDTTGYNTAKDVAVVYVKKTF* |
| Ga0068860_1012943271 | 3300005843 | Switchgrass Rhizosphere | IPDGVMKGLEVGAYYTGNNAKSLPYTDLTNYDTSKDRGVLYVKKTF* |
| Ga0066652_1013411111 | 3300006046 | Soil | IEFGAYYTGNNANTAFYTDLNGFNTAKDTGVAYVKKTF* |
| Ga0075026_1005668781 | 3300006057 | Watersheds | GVEVGAYYSANDAKKAFYTDLTGYNTAKSTGVVYVKKTF* |
| Ga0079037_1010143231 | 3300006224 | Freshwater Wetlands | ADGVLKGVEFGAYYSGNNAENAFYTDLTGYNTAKDRGVVYVKKTF* |
| Ga0079037_1014874083 | 3300006224 | Freshwater Wetlands | VGAYYSGNNAKEGFYTDLTGYNTAKDRGVFYVKKTF* |
| Ga0079222_110096271 | 3300006755 | Agricultural Soil | DGTVFKGLEVGAYYTDNNAKEPFYTDLTGYDTSKARGVVYVKKTF* |
| Ga0079220_121020841 | 3300006806 | Agricultural Soil | LGAYYTDNNAREAFYTDLTGYDTSKARGVVYVKKTF* |
| Ga0075428_1008213621 | 3300006844 | Populus Rhizosphere | KGFEVGAYYSGNNAKKAFYTDTTGYNTAKDVGVVYVKKTF* |
| Ga0079217_103562493 | 3300006876 | Agricultural Soil | AYTVPVGAVKGLELGAYYTDNDAKKRFYTDLTGYDTSKARGVVYVKKTF* |
| Ga0105090_100033959 | 3300009075 | Freshwater Sediment | VAEGAFKGVEVGAYYSGNNAKKAFYTGLTGYNIAKDVGVVFIKKTS* |
| Ga0105092_108187111 | 3300009157 | Freshwater Sediment | GVEVGAYYSGNTAKSAFYTDLTGYDTSKDRGVVYVKKTF* |
| Ga0113563_110439264 | 3300009167 | Freshwater Wetlands | VPDGVLKGVEFGAYYSGNNAESAFYTDPTGYNNGKEIGVVYVKKTF* |
| Ga0105242_119839713 | 3300009176 | Miscanthus Rhizosphere | GAYYTGNNAKSLPYTDLTNYDTSKDRGVLYVKKTF* |
| Ga0115028_112035573 | 3300009179 | Wetland | GAFKGIEVGAYYSGNNAKKAFYTDLTGYNTAKDVGVVYVKKTF* |
| Ga0105237_113946893 | 3300009545 | Corn Rhizosphere | FKGLEVGAYYTDNNAKEPFYTDLTGYDTSKARGVVYVKKTF* |
| Ga0116146_13652202 | 3300009664 | Anaerobic Digestor Sludge | GVFKGLEIGAYYSGNNAESIPYTDLNGYDTAKDRGVVYVKKTF* |
| Ga0126313_110652113 | 3300009840 | Serpentine Soil | AKGLELGAYYTDNNAQQAFYTDLTGYDTAKARGVIYVKKTF* |
| Ga0134109_102960463 | 3300010320 | Grasslands Soil | PDGVLKGIEFGAYYTGNNANTAFYTDLNGFNTAKDTGVAYVKKTF* |
| Ga0134065_102489261 | 3300010326 | Grasslands Soil | GAYYTDSNAKQRFYTDLTGYDTTKARGVVYVKKTF* |
| Ga0137399_110252441 | 3300012203 | Vadose Zone Soil | GIEVGAYYTGNNAKSAFYTDLTNYNTAKDRGVVYVKKTF* |
| Ga0136614_104475373 | 3300012684 | Polar Desert Sand | AYYAGNNAKSRFYTDLSGYDTSKDRGVVYVKKTF* |
| Ga0157282_100688133 | 3300012904 | Soil | GGSYTIPDGVMKGLELGAYYTGNNAKSLPYTDLTNYDTSKDRGVFYVKKTF* |
| Ga0075359_11066851 | 3300014266 | Natural And Restored Wetlands | LFKGTEIGAYYSGNNAESAPYTDLTGYNTAKSVGVVYVKKTF* |
| Ga0075349_10600473 | 3300014305 | Natural And Restored Wetlands | LEIGAYYSDTNSDGGFYTDLTGKDTAKATGVVYVKKTF* |
| Ga0180104_12571761 | 3300014884 | Soil | DGVLKGIEIGAYYTGNNAKSPFYTYLTGYDTSKDRGVVYVKKTF* |
| Ga0180077_11317501 | 3300015255 | Soil | GLEIGAYYSGNNAQSTPYTDLTGYNTAKDRGVVYVKKTF* |
| Ga0132258_101177914 | 3300015371 | Arabidopsis Rhizosphere | VPDGFFKSFEIGAYYTGNTANEGFYTDLTGYNMAKDAGIAYIKKTF* |
| Ga0132255_1007920183 | 3300015374 | Arabidopsis Rhizosphere | VPDGFFKSFEIGAYYTGNTANEGFYTDLTGYNTAKDAGIVYIKKTF* |
| Ga0132255_1036334763 | 3300015374 | Arabidopsis Rhizosphere | GSYGVGDGLLKGFEFGAYYTSNDANKAFYTDTTGYNTPKNAFVGYVKKTF* |
| Ga0132255_1045719761 | 3300015374 | Arabidopsis Rhizosphere | AYYTGNNAKSLPYTDLTNYDTSKDRGVVYVKKTF* |
| Ga0132255_1049483082 | 3300015374 | Arabidopsis Rhizosphere | FLKGVEVGAYYSWNNANDAFYTDLTGYNTGKNRGVVYVKKTF* |
| Ga0184604_103024501 | 3300018000 | Groundwater Sediment | KNVEVGAYYTGNDAKQRFYTDLTGYNTAKDRGVVYVKKTF |
| Ga0190265_133129941 | 3300018422 | Soil | LGAYYTDNDAKKRFYTDLNGYDTTKARGVVYVKKTF |
| Ga0066655_102354773 | 3300018431 | Grasslands Soil | KGIEFGAYYTGNNANTAFYTDLNGFNTAKDTGVAYVKKTF |
| Ga0210378_100925391 | 3300021073 | Groundwater Sediment | GVLKGIELGAYYTGNNAKSAFYTDLTGRDTAKDRGVVYVKKTF |
| Ga0210379_103900721 | 3300021081 | Groundwater Sediment | DGVLKGIEVGAYYTGNNAKSAFYTDLTGRDTAKDRGVVYVKKTF |
| Ga0193719_101736411 | 3300021344 | Soil | NVEVGAYYTGNDAKQRFYTDLTGYNTAKDRGVVYVKKTF |
| Ga0210409_113077291 | 3300021559 | Soil | VIKGVEVGAYYTGNDAKKRFYTDLTGYNTAKDRGIFYVKKTF |
| Ga0247752_10737652 | 3300023071 | Soil | IPDGVLKGLELGAYYTGNNAKSLPYTDLTNYDTSKDRGVFYVKKTF |
| Ga0207656_100492871 | 3300025321 | Corn Rhizosphere | LEVGAYYSGNDAKKAFYTDTTGYNTAKDVAVVYVKKTF |
| Ga0207707_105274771 | 3300025912 | Corn Rhizosphere | NVEVGAYYTGNDAKSRFYTDMSGYNTAKDRGVVYVKKTF |
| Ga0207681_102024843 | 3300025923 | Switchgrass Rhizosphere | IGAYYTGNNAKSLPYTDLTNYDTSKDRGVLYVKKTF |
| Ga0207681_114518271 | 3300025923 | Switchgrass Rhizosphere | LELGAYYTGNNAKSLPYTDLTNYDTSKDRGVFYVKKTF |
| Ga0207690_105288721 | 3300025932 | Corn Rhizosphere | TVADGLFKGTELGAYYTDNNAREAFYTDLTGYDTSKARGVVYVKKTF |
| Ga0207691_109085141 | 3300025940 | Miscanthus Rhizosphere | TIPDGVLKGLELGAYYTGNNAKSLPYTDLTNYDTSKDRGVLYVKKTF |
| Ga0207711_103441311 | 3300025941 | Switchgrass Rhizosphere | LMKGLEIGAYYTGNNAKSLPYTDLTNYDTSKDRGVLYVKKTF |
| Ga0210104_10353853 | 3300025956 | Natural And Restored Wetlands | VPEGVFKGLEIGAYYSDTNSDGGFYTDLTGRDTAKSTGVVYVKKTF |
| Ga0207668_105922921 | 3300025972 | Switchgrass Rhizosphere | PDGLMKGLEIGAYYTGNNAKSLPYTDLTNYDTSKDRGVFYVKKTF |
| Ga0208415_10182481 | 3300025993 | Rice Paddy Soil | YTVPDGLFRNVEIGAYYTGNDAKSRFYTDLSGYDTAKDRGVVYVKKTF |
| Ga0207639_100181171 | 3300026041 | Corn Rhizosphere | VEVGAYYTDNDAKAPFYTDATGYDTSKARGVVYVKKTF |
| Ga0207678_101095591 | 3300026067 | Corn Rhizosphere | TELGAYYTDNNAREAFYTDLTGYDTSKARGVVYVKKTF |
| Ga0207641_123194062 | 3300026088 | Switchgrass Rhizosphere | WKIGFSYTVPDGLFKNVELGAYYTGSDAKSRFYTDLTGLDTSRNRGVAYVKKTF |
| Ga0209856_10034263 | 3300026837 | Sand | SYTVPDGLFKGTEIGAYYSGNNAESAPYTDLTGYNTAKSVGVVYVKKTF |
| Ga0209798_103042693 | 3300027843 | Wetland Sediment | ASYTVPDGALKGIEVGAYYTGNDAKSRFYTDLTGYDTSKDRGVVYVKKTF |
| Ga0209069_101497051 | 3300027915 | Watersheds | VPDGLFKNVEVGAYYTGNTANAGYYTDLTGYNTAKDAGIVYVKKTF |
| Ga0209391_100318323 | 3300027975 | Freshwater Sediment | VAEGAFKGVEVGAYYSGNNAKKAFYTGLTGYNIAKDVGVVFIKKTS |
| Ga0209391_101456863 | 3300027975 | Freshwater Sediment | GAEIGAYYSGNNATEAFYTDLNGYNTAKDRGVFYIKKTF |
| Ga0268264_101373521 | 3300028381 | Switchgrass Rhizosphere | VMKGLEVGAYYTGNNAKSLPYTDLTNYDTSKDRGVLYVKKTF |
| Ga0268264_107893011 | 3300028381 | Switchgrass Rhizosphere | KNVEIGAYYTGNTANEGFYTDLTGYNTAKDAGIVYVKKTF |
| Ga0302254_100539011 | 3300028870 | Fen | VEIGAYYTGNTANSGFYTDLTGYNTAKDAGIVYVKKTF |
| (restricted) Ga0255310_101539993 | 3300031197 | Sandy Soil | YTIPDGVLKGLEVGAYYTGNDAKSAPYTDLTGYDTSKDRGVVYVKKTF |
| Ga0307408_1024525682 | 3300031548 | Rhizosphere | EVGAYYSGNDAKRAFYTDITGYDTSKDRGVVYVKKTF |
| Ga0307469_106418131 | 3300031720 | Hardwood Forest Soil | WKAGVSYTVPDGVLKGVEFGAYYSGNNANSSFYTDLNNYDTAKDRGVFYVKKTF |
| Ga0307410_101525001 | 3300031852 | Rhizosphere | VGAYYSGNDAKRAFYTDFTGYDTSKDRGVVYVKKTF |
| Ga0307410_118339161 | 3300031852 | Rhizosphere | AKGLELGAYYTGNNATRPFYTDLTGYDTSKARIVGYVKKTF |
| Ga0306925_102714931 | 3300031890 | Soil | VLKGIEFGAYYTGNDAKSAFYTDLSGYNTARDRGVVYVKKTF |
| Ga0318559_105913101 | 3300032039 | Soil | VSYVVPDGVLKGIEFGAYYTGNDAKSAFYTDLSGYNTARDRGVVYVKKTF |
| Ga0318514_108005461 | 3300032066 | Soil | VSYTAPDGFFKNFEVGAYYTGSDAKSRFYTDLTGRDTSKDRGVIYVKKTF |
| Ga0307415_1012645961 | 3300032126 | Rhizosphere | LGAYYTGNNATRPFYTDLTGYDTSKARIVGYVKKTF |
| Ga0315281_120417251 | 3300032163 | Sediment | KGVEVGAYYSGNNAKKAFYTDLTGYNTAKDVGVVYVKKTF |
| Ga0315283_116294241 | 3300032164 | Sediment | LKNLEIGAYYTGNTANAGFYTDLTGYNTAKDTGVVYVKKTF |
| Ga0315283_118992001 | 3300032164 | Sediment | FKGVEVGAYYSGNNAKKAFYTDLTGYNTAKDVGVVYVKKTF |
| Ga0307471_1023128771 | 3300032180 | Hardwood Forest Soil | VEIGAYYTGNTANQGFYTDLTGYNTAKDAGIVYIKKTF |
| Ga0315287_111076203 | 3300032397 | Sediment | EVGAYYSGNNAKKAFYTDLTGYNTAKDVGVVYVKKTF |
| Ga0315273_113731813 | 3300032516 | Sediment | FKGVEVGAYYSGNNAKKAFYTDLTGYNTAKDTGVVYVKKTF |
| Ga0316605_111500051 | 3300033408 | Soil | SSPHCSGTRAASYTVPDGVLKGVEFGAYYSGNNAESAFYTDPAGYNTGKEIGVVYVKKTF |
| Ga0310810_111148193 | 3300033412 | Soil | GASYTIPDGVLKGLELGAYYTGNNAKSLPYTDLTNYDTSKDRGVFYVKKTF |
| Ga0316603_102416681 | 3300033413 | Soil | VPDGVLKGVEFGAYYSGNNAESAFYTDPTGYNTGKEIGVVYVKKTF |
| Ga0316603_123049962 | 3300033413 | Soil | VPDGLFKGLEIGAYYSDTNSDGGFYTDLTGKDTAKSTGVVYVKKTF |
| Ga0316625_1014918993 | 3300033418 | Soil | EIGAYYTGNTAKSAFYTDLTGYDTGKDRGVVYVKKTF |
| Ga0326726_121101652 | 3300033433 | Peat Soil | AVADGPLKGFEVGAYYVGNTANKVFYTDLTGYNTAKDTGVVYVKKTF |
| Ga0316621_106767221 | 3300033488 | Soil | MKGVEVGAYYSGNNAKEGFYTDLTGYNTAKDRGVVYMKKTF |
| Ga0364943_0017225_1_120 | 3300034354 | Sediment | GFEVGAYYTGNNAKSAFYTDLTGRDTAKDRGVVYVKKTF |
| ⦗Top⦘ |