


| Basic Information | |
|---|---|
| Family ID | F105370 |
| Family Type | Metagenome |
| Number of Sequences | 100 |
| Average Sequence Length | 37 residues |
| Representative Sequence | HNEVNIKALEKAVTKLQSDVEKLKDKQREFGNGNSH |
| Number of Associated Samples | 66 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 3.00 % |
| % of genes near scaffold ends (potentially truncated) | 94.00 % |
| % of genes from short scaffolds (< 2000 bps) | 91.00 % |
| Associated GOLD sequencing projects | 59 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (62.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (50.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (97.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (87.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.12% β-sheet: 0.00% Coil/Unstructured: 46.88% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF08291 | Peptidase_M15_3 | 19.00 |
| PF00313 | CSD | 12.00 |
| PF08007 | JmjC_2 | 1.00 |
| PF00011 | HSP20 | 1.00 |
| PF01555 | N6_N4_Mtase | 1.00 |
| PF01106 | NifU | 1.00 |
| PF14528 | LAGLIDADG_3 | 1.00 |
| PF00856 | SET | 1.00 |
| PF13759 | 2OG-FeII_Oxy_5 | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 1.00 |
| COG0694 | Fe-S cluster biogenesis protein NfuA, 4Fe-4S-binding domain | Posttranslational modification, protein turnover, chaperones [O] | 1.00 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 1.00 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 1.00 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 1.00 |
| COG2850 | Ribosomal protein L16 Arg81 hydroxylase, contains JmjC domain | Translation, ribosomal structure and biogenesis [J] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 62.00 % |
| All Organisms | root | All Organisms | 37.00 % |
| unclassified Hyphomonas | no rank | unclassified Hyphomonas | 1.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000260|LP_A_09_P20_500DRAFT_1016912 | Not Available | 1091 | Open in IMG/M |
| 3300001727|JGI24529J20061_100959 | Not Available | 1377 | Open in IMG/M |
| 3300001727|JGI24529J20061_104756 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 673 | Open in IMG/M |
| 3300001728|JGI24521J20086_1007005 | Not Available | 1023 | Open in IMG/M |
| 3300001732|JGI24652J20063_1032704 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 515 | Open in IMG/M |
| 3300001735|JGI24520J20079_1000686 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 2758 | Open in IMG/M |
| 3300001743|JGI24515J20084_1000930 | Not Available | 2462 | Open in IMG/M |
| 3300002511|JGI25131J35506_1003643 | Not Available | 2215 | Open in IMG/M |
| 3300002511|JGI25131J35506_1058412 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300005969|Ga0066369_10165545 | Not Available | 731 | Open in IMG/M |
| 3300006304|Ga0068504_1334991 | Not Available | 569 | Open in IMG/M |
| 3300006340|Ga0068503_10522581 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 1479 | Open in IMG/M |
| 3300006340|Ga0068503_11003904 | Not Available | 646 | Open in IMG/M |
| 3300006751|Ga0098040_1086784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Marinovum → unclassified Marinovum → Marinovum sp. | 949 | Open in IMG/M |
| 3300006753|Ga0098039_1315879 | Not Available | 521 | Open in IMG/M |
| 3300006754|Ga0098044_1007046 | All Organisms → cellular organisms → Bacteria → FCB group | 5437 | Open in IMG/M |
| 3300006789|Ga0098054_1269933 | Not Available | 611 | Open in IMG/M |
| 3300006793|Ga0098055_1159973 | All Organisms → Viruses | 864 | Open in IMG/M |
| 3300006900|Ga0066376_10176544 | All Organisms → Viruses | 1291 | Open in IMG/M |
| 3300006923|Ga0098053_1105677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 567 | Open in IMG/M |
| 3300006923|Ga0098053_1123433 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 519 | Open in IMG/M |
| 3300006925|Ga0098050_1188707 | Not Available | 514 | Open in IMG/M |
| 3300006926|Ga0098057_1084635 | Not Available | 773 | Open in IMG/M |
| 3300006927|Ga0098034_1160499 | Not Available | 633 | Open in IMG/M |
| 3300006928|Ga0098041_1276483 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 534 | Open in IMG/M |
| 3300008216|Ga0114898_1180864 | Not Available | 595 | Open in IMG/M |
| 3300008219|Ga0114905_1114947 | Not Available | 921 | Open in IMG/M |
| 3300008219|Ga0114905_1260564 | Not Available | 543 | Open in IMG/M |
| 3300008219|Ga0114905_1274977 | Not Available | 523 | Open in IMG/M |
| 3300008220|Ga0114910_1083605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Marinovum → unclassified Marinovum → Marinovum sp. | 970 | Open in IMG/M |
| 3300009412|Ga0114903_1021068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Marinovum → unclassified Marinovum → Marinovum sp. | 1684 | Open in IMG/M |
| 3300009412|Ga0114903_1043123 | Not Available | 1076 | Open in IMG/M |
| 3300009413|Ga0114902_1026516 | Not Available | 1819 | Open in IMG/M |
| 3300009414|Ga0114909_1182810 | Not Available | 540 | Open in IMG/M |
| 3300009436|Ga0115008_11039358 | Not Available | 613 | Open in IMG/M |
| 3300009603|Ga0114911_1120348 | Not Available | 753 | Open in IMG/M |
| 3300009604|Ga0114901_1066589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Marinovum → unclassified Marinovum → Marinovum sp. | 1199 | Open in IMG/M |
| 3300009604|Ga0114901_1110418 | Not Available | 857 | Open in IMG/M |
| 3300009605|Ga0114906_1087536 | Not Available | 1133 | Open in IMG/M |
| 3300009605|Ga0114906_1162713 | Not Available | 764 | Open in IMG/M |
| 3300009619|Ga0105236_1022314 | Not Available | 743 | Open in IMG/M |
| 3300009619|Ga0105236_1039110 | Not Available | 606 | Open in IMG/M |
| 3300009619|Ga0105236_1045141 | Not Available | 576 | Open in IMG/M |
| 3300009620|Ga0114912_1090191 | Not Available | 742 | Open in IMG/M |
| 3300009620|Ga0114912_1125133 | Not Available | 607 | Open in IMG/M |
| 3300009622|Ga0105173_1027679 | Not Available | 886 | Open in IMG/M |
| 3300010150|Ga0098056_1194126 | Not Available | 679 | Open in IMG/M |
| 3300010155|Ga0098047_10140912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Marinovum → unclassified Marinovum → Marinovum sp. | 934 | Open in IMG/M |
| 3300010155|Ga0098047_10264830 | Not Available | 652 | Open in IMG/M |
| 3300017773|Ga0181386_1270686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300019757|Ga0193964_1073708 | Not Available | 737 | Open in IMG/M |
| 3300021442|Ga0206685_10181684 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 706 | Open in IMG/M |
| 3300021973|Ga0232635_1186954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300022178|Ga0196887_1033178 | Not Available | 1422 | Open in IMG/M |
| (restricted) 3300024518|Ga0255048_10018730 | All Organisms → Viruses → environmental samples → uncultured virus | 3572 | Open in IMG/M |
| (restricted) 3300024518|Ga0255048_10037257 | Not Available | 2459 | Open in IMG/M |
| (restricted) 3300024520|Ga0255047_10169061 | Not Available | 1116 | Open in IMG/M |
| 3300025044|Ga0207891_1008814 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 1630 | Open in IMG/M |
| 3300025044|Ga0207891_1009773 | Not Available | 1480 | Open in IMG/M |
| 3300025044|Ga0207891_1017465 | Not Available | 934 | Open in IMG/M |
| 3300025045|Ga0207901_1038183 | Not Available | 646 | Open in IMG/M |
| 3300025045|Ga0207901_1048962 | Not Available | 560 | Open in IMG/M |
| 3300025046|Ga0207902_1033099 | All Organisms → Viruses | 635 | Open in IMG/M |
| 3300025046|Ga0207902_1052301 | All Organisms → Viruses | 512 | Open in IMG/M |
| 3300025052|Ga0207906_1003090 | Not Available | 2633 | Open in IMG/M |
| 3300025096|Ga0208011_1074399 | Not Available | 751 | Open in IMG/M |
| 3300025114|Ga0208433_1071577 | Not Available | 891 | Open in IMG/M |
| 3300025114|Ga0208433_1083857 | All Organisms → Viruses | 807 | Open in IMG/M |
| 3300025125|Ga0209644_1032743 | Not Available | 1162 | Open in IMG/M |
| 3300025125|Ga0209644_1045311 | Not Available | 1000 | Open in IMG/M |
| 3300025125|Ga0209644_1079261 | Not Available | 769 | Open in IMG/M |
| 3300025125|Ga0209644_1079306 | Not Available | 768 | Open in IMG/M |
| 3300025125|Ga0209644_1106879 | Not Available | 663 | Open in IMG/M |
| 3300025125|Ga0209644_1112369 | Not Available | 647 | Open in IMG/M |
| 3300025133|Ga0208299_1104435 | All Organisms → Viruses | 952 | Open in IMG/M |
| 3300025259|Ga0207876_1043847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300025264|Ga0208029_1046032 | All Organisms → Viruses | 934 | Open in IMG/M |
| 3300025274|Ga0208183_1061139 | Not Available | 736 | Open in IMG/M |
| 3300025282|Ga0208030_1151902 | All Organisms → Viruses | 542 | Open in IMG/M |
| 3300025282|Ga0208030_1168417 | Not Available | 504 | Open in IMG/M |
| 3300025296|Ga0208316_1067061 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 701 | Open in IMG/M |
| 3300025296|Ga0208316_1099295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 521 | Open in IMG/M |
| 3300025300|Ga0208181_1069833 | Not Available | 698 | Open in IMG/M |
| 3300025873|Ga0209757_10015439 | All Organisms → Viruses | 2078 | Open in IMG/M |
| 3300025873|Ga0209757_10031931 | Not Available | 1503 | Open in IMG/M |
| 3300025873|Ga0209757_10036196 | Not Available | 1422 | Open in IMG/M |
| 3300025873|Ga0209757_10069262 | Not Available | 1054 | Open in IMG/M |
| 3300025873|Ga0209757_10163098 | Not Available | 700 | Open in IMG/M |
| 3300025873|Ga0209757_10168972 | Not Available | 688 | Open in IMG/M |
| 3300025873|Ga0209757_10208024 | All Organisms → Viruses | 620 | Open in IMG/M |
| 3300025873|Ga0209757_10276400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300026117|Ga0208317_1015677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300031800|Ga0310122_10341946 | Not Available | 650 | Open in IMG/M |
| 3300031886|Ga0315318_10001381 | Not Available | 10605 | Open in IMG/M |
| 3300034628|Ga0326755_007591 | Not Available | 1016 | Open in IMG/M |
| 3300034628|Ga0326755_028309 | unclassified Hyphomonas → Hyphomonas sp. | 565 | Open in IMG/M |
| 3300034629|Ga0326756_049745 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 521 | Open in IMG/M |
| 3300034654|Ga0326741_015196 | Not Available | 1395 | Open in IMG/M |
| 3300034656|Ga0326748_019815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium | 900 | Open in IMG/M |
| 3300034658|Ga0326751_027336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → environmental samples → uncultured Alphaproteobacteria bacterium | 563 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 50.00% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 25.00% |
| Filtered Seawater | Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater | 6.00% |
| Marine Oceanic | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic | 5.00% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 4.00% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 3.00% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.00% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater Microbial Mat | 1.00% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.00% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.00% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 1.00% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000260 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P20_500 | Environmental | Open in IMG/M |
| 3300001727 | Marine viral communities from the Pacific Ocean - LP-55 | Environmental | Open in IMG/M |
| 3300001728 | Marine viral communities from the Pacific Ocean - LP-46 | Environmental | Open in IMG/M |
| 3300001732 | Marine viral communities from the Deep Pacific Ocean - MSP-97 | Environmental | Open in IMG/M |
| 3300001735 | Marine viral communities from the Pacific Ocean - LP-45 | Environmental | Open in IMG/M |
| 3300001743 | Marine viral communities from the Pacific Ocean - LP-38 | Environmental | Open in IMG/M |
| 3300002511 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 | Environmental | Open in IMG/M |
| 3300005969 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_Bottom_ad_4513_LV_A | Environmental | Open in IMG/M |
| 3300006304 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_1000m | Environmental | Open in IMG/M |
| 3300006340 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0770m | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006900 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_Bottom_ad_5009_LV_A | Environmental | Open in IMG/M |
| 3300006923 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006926 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG | Environmental | Open in IMG/M |
| 3300006927 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300008216 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar | Environmental | Open in IMG/M |
| 3300008219 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 | Environmental | Open in IMG/M |
| 3300008220 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 | Environmental | Open in IMG/M |
| 3300009412 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2 | Environmental | Open in IMG/M |
| 3300009413 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 | Environmental | Open in IMG/M |
| 3300009414 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009603 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 | Environmental | Open in IMG/M |
| 3300009604 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 | Environmental | Open in IMG/M |
| 3300009605 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 | Environmental | Open in IMG/M |
| 3300009619 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3827_250 | Environmental | Open in IMG/M |
| 3300009620 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_51 | Environmental | Open in IMG/M |
| 3300009622 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3321_4155 | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300019757 | Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - FB_7_MG | Environmental | Open in IMG/M |
| 3300021442 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 | Environmental | Open in IMG/M |
| 3300021973 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Alice_FS923 _150kmer | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300024520 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1 | Environmental | Open in IMG/M |
| 3300025044 | Marine viral communities from the Pacific Ocean - LP-50 (SPAdes) | Environmental | Open in IMG/M |
| 3300025045 | Marine viral communities from the Pacific Ocean - LP-46 (SPAdes) | Environmental | Open in IMG/M |
| 3300025046 | Marine viral communities from the Pacific Ocean - LP-45 (SPAdes) | Environmental | Open in IMG/M |
| 3300025052 | Marine viral communities from the Pacific Ocean - LP-37 (SPAdes) | Environmental | Open in IMG/M |
| 3300025096 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025114 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025125 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025259 | Marine viral communities from the Deep Pacific Ocean - MSP-146 (SPAdes) | Environmental | Open in IMG/M |
| 3300025264 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025274 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_51 (SPAdes) | Environmental | Open in IMG/M |
| 3300025282 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 (SPAdes) | Environmental | Open in IMG/M |
| 3300025296 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 (SPAdes) | Environmental | Open in IMG/M |
| 3300025300 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 (SPAdes) | Environmental | Open in IMG/M |
| 3300025873 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300026117 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3635_2500 (SPAdes) | Environmental | Open in IMG/M |
| 3300031800 | Marine microbial communities from Western Arctic Ocean, Canada - CB6_Bottom_1051 | Environmental | Open in IMG/M |
| 3300031886 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 3416 | Environmental | Open in IMG/M |
| 3300034628 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 543_2961 | Environmental | Open in IMG/M |
| 3300034629 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 543_2600 | Environmental | Open in IMG/M |
| 3300034654 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 487_2244 | Environmental | Open in IMG/M |
| 3300034656 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 502_2477 | Environmental | Open in IMG/M |
| 3300034658 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 524_CTD | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| LP_A_09_P20_500DRAFT_10169125 | 3300000260 | Marine | QEAGIHNEVMIKFLEKAVNKLQNDVEKLKDRQREFTNGNGVH* |
| JGI24529J20061_1009591 | 3300001727 | Marine | VMIKFLEKAVNKLQNDVEKLKDKQRDFTNGSGVH* |
| JGI24529J20061_1047561 | 3300001727 | Marine | MLHNEVGIKALDKAVDKLQRDVEKLKDKQRAFANGNSHD* |
| JGI24521J20086_10070053 | 3300001728 | Marine | HNEVMIKFLEKAVNKLQNDVEKLKDKQRDFSNGNRTH* |
| JGI24652J20063_10327043 | 3300001732 | Deep Ocean | RVDSMLHNENEVGIKALDKATEKLQNDVEKLKDKQRDFANGNQ* |
| JGI24520J20079_100068612 | 3300001735 | Marine | NEVMIKFLEKAVNKLQNDVEKLKDKQRDFTNGNNHE* |
| JGI24515J20084_10009301 | 3300001743 | Marine | HNEVMIKFLEKAVNKLQNDVEKLKDRQREFTNGNGVH* |
| JGI25131J35506_10036431 | 3300002511 | Marine | AQQEAGIHNEVMIKFLDEQVKKLQSDVEKLKDRQREFTNGKIQ* |
| JGI25131J35506_10584123 | 3300002511 | Marine | LQLQQEAGIHNEVMIKFLDEQVKKLQTDVEKLKDKQRDFTNGTHQ* |
| Ga0066369_101655451 | 3300005969 | Marine | NEVNIKALEKSVDKLQRDVEKLKDKQRAFANGDIQ* |
| Ga0068504_13349913 | 3300006304 | Marine | NIAALNKAVEKLQSDVEKLKDKQRQFANGS**SKLL* |
| Ga0068503_105225814 | 3300006340 | Marine | VDSKIHNEVGIKALDKAVDKLQKDVEKLKDKQRTFSNGGTS* |
| Ga0068503_110039044 | 3300006340 | Marine | AGVKAQIKALDKAVEKLQSDVEKLKDKQRTFSNGNQ* |
| Ga0098040_10867841 | 3300006751 | Marine | NEVNISALTKAVDKLQSDVEKLKDKQREFGNGGNH* |
| Ga0098039_13158791 | 3300006753 | Marine | HNEVMIKFLDEQVKKLQNDVEKLKDRQREFTNGKIQ* |
| Ga0098044_10070461 | 3300006754 | Marine | LQAQQEAGIHNEVMIKFLEEQVKKLQEDVEKLKDKQRDFSNGSKE* |
| Ga0098054_12699333 | 3300006789 | Marine | HNEVNIEALTKAVNKLQSDVEKLKDRQRQFANGE* |
| Ga0098055_11599735 | 3300006793 | Marine | EVMIKFLDEQVKKLQEDVEKLKDKQRDFSNGNGG* |
| Ga0066376_101765441 | 3300006900 | Marine | NEVGIKALDKATEKLQNDVEKLKDKQRTFSNGNQ* |
| Ga0098053_11056771 | 3300006923 | Marine | QQEAGIHNEVMIKFLDEQVKKLQEDVEKLKDKQRDFSNGNHQ* |
| Ga0098053_11234333 | 3300006923 | Marine | QERIDGMLHNAVNIDALTKAVEKLQRDVERLKDKRREFGNGNGSH* |
| Ga0098050_11887073 | 3300006925 | Marine | DSMMHNEVNIEALTKAVNKLQSDVEKLKDRQRQFANGE* |
| Ga0098057_10846351 | 3300006926 | Marine | HNEINISALTKAVEKLQSDVEKLKDKQREFSNGGTH* |
| Ga0098034_11604993 | 3300006927 | Marine | EVNISALTKAVDKLQSDVEKLKDKQREFGNGNSH* |
| Ga0098041_12764833 | 3300006928 | Marine | VNIEALTKAVNKLQSDVEKLKDKQRAFANGNGAH* |
| Ga0114898_11808641 | 3300008216 | Deep Ocean | NKVNIEALEKAVDKLQSDVEKLKDKQREFGNGGNH* |
| Ga0114905_11149471 | 3300008219 | Deep Ocean | HNDVNIKALEKAVEKLQKDVEKLKDKQRTFSNGNNH* |
| Ga0114905_12605641 | 3300008219 | Deep Ocean | NEVNITALNKAVEKLQSDVEKLKDKQRQFANGDK* |
| Ga0114905_12749771 | 3300008219 | Deep Ocean | NEVNITALNKAVEKLQGDVEKLKDKQRSFANGNNH* |
| Ga0114910_10836053 | 3300008220 | Deep Ocean | GMLHNEVNINALEKAVDKLQSDVEKLKDKQREFGNGGTH* |
| Ga0114903_10210685 | 3300009412 | Deep Ocean | LHNEVNISALTKAVEKLQSDVEKLKDKQREFGNGGNH* |
| Ga0114903_10431231 | 3300009412 | Deep Ocean | AVNIEALEKAVEKLQKDVERLKDKQREFGNGGTH* |
| Ga0114902_10265168 | 3300009413 | Deep Ocean | LHNAVNIEALEKAVEKLQIDVEKLKDKQREFSNGSNH* |
| Ga0114909_11828101 | 3300009414 | Deep Ocean | HNEVNIKALEKAVTKLQSDVEKLKDKQREFGNGNSH* |
| Ga0115008_110393584 | 3300009436 | Marine | HNEVNITALAKAVDKLQKDVEKLKDKQRTFSNGNGVH* |
| Ga0114911_11203481 | 3300009603 | Deep Ocean | EVNISALTKAVDKLQSDVEKLKDKQREFGNGGNH* |
| Ga0114901_10665891 | 3300009604 | Deep Ocean | AVNIDALTKAVEKLQSDVEKLKDKQREFGNGGNH* |
| Ga0114901_11104184 | 3300009604 | Deep Ocean | EVNITALNKAVEKLQGDVEKLKDKQRSFANGNNH* |
| Ga0114906_10875361 | 3300009605 | Deep Ocean | EVMIKFLDEQVKKLQSDVEKLKDKQRDFANGNKE* |
| Ga0114906_11627133 | 3300009605 | Deep Ocean | HNEVNIEALDKAVEKLQKDVERLKDKQREFGNGGNH* |
| Ga0105236_10223141 | 3300009619 | Marine Oceanic | HNEVNISALSKAVEKLQVDVEKLKDKQRAFSNGSTH* |
| Ga0105236_10391103 | 3300009619 | Marine Oceanic | MDKLQIRVDSMLHNEVGIKALDKAVEKLQSDVEKLKDKQ |
| Ga0105236_10451411 | 3300009619 | Marine Oceanic | GMLHNEVNINALEKAVDKLQSDVEKLKDKQREFGNGNSH* |
| Ga0114912_10901914 | 3300009620 | Deep Ocean | MLHNEVNIKALEKAVTKLQSDVEKLKDKQREFGNGNSH* |
| Ga0114912_11251331 | 3300009620 | Deep Ocean | HNEVNINALEKAVDKLQSDVEKLKDKQREFGNGGTH* |
| Ga0105173_10276791 | 3300009622 | Marine Oceanic | HNEVNIKALEKAVEKLQKDVERLKDKQREFGNGNGSNH* |
| Ga0098056_11941261 | 3300010150 | Marine | NEVNISALSKAVDKLQSDVEKLKDKQREFGNGSNH* |
| Ga0098047_101409121 | 3300010155 | Marine | NEVNIKALDKAVNKLQSDVEKLKDKQRSFSNGEH* |
| Ga0098047_102648301 | 3300010155 | Marine | NEVMIKFLDEQVKKLQEDVEKLKDKQRDFSNGNGG* |
| Ga0181386_12706861 | 3300017773 | Seawater | NEVNISALSKAVEKLQSDVEKLKDKQRAFSNGSTH |
| Ga0193964_10737081 | 3300019757 | Freshwater Microbial Mat | NKVNIEFLKDQVEKLQRDVEKLKDKQRDFANGNNH |
| Ga0206685_101816842 | 3300021442 | Seawater | LKMDSMTHNEVNINVLQDDVDDLKDDVERLKDKQREFSNGQK |
| Ga0232635_11869542 | 3300021973 | Hydrothermal Vent Fluids | MLHNEVGIKALDKAVDKLQKDVEKLKDKQRDFANGEQ |
| Ga0196887_10331785 | 3300022178 | Aqueous | EVNITALAKAVDKLQKDVEKLKDKQRTFSNGNGVH |
| (restricted) Ga0255048_1001873013 | 3300024518 | Seawater | VDSMLHNEVNIKALEKAVEKLQKDVERLKDKQREFGNGSTH |
| (restricted) Ga0255048_1003725712 | 3300024518 | Seawater | AGIHNEVMIKFLEKAVNKLQNDVEKLKDKQREFTNGNGVH |
| (restricted) Ga0255047_101690611 | 3300024520 | Seawater | KLQLQQEAGIHNEVMIKFLDEQVKKLQADVEKLKDKQREFSNGGTH |
| Ga0207891_10088141 | 3300025044 | Marine | HNEVGIKALDKATEKLQNDVEKLKDKQRTFSNGNQ |
| Ga0207891_10097731 | 3300025044 | Marine | HNDVNIKSLEKAVDKLQRDVEKLKDKQRSFSNGNEHD |
| Ga0207891_10174651 | 3300025044 | Marine | LQLQQEAGIHNEVMIKFLEKAVNKLQNDVEKLKDRQREFTNGSGVH |
| Ga0207901_10381833 | 3300025045 | Marine | AGIHNEVMIKFLEKAVNKLQNDVEKLKDKQREFTNGNEAH |
| Ga0207901_10489623 | 3300025045 | Marine | IHNEVMIKFLDEQVKKLQDDVEKLKDKQRDFSNGNRTH |
| Ga0207902_10330991 | 3300025046 | Marine | HNAVNIEALHKAVDKLQKDVEKLKDKQRTFSNGND |
| Ga0207902_10523013 | 3300025046 | Marine | DSMLHNEIGIKALDKAVDKLQKDVEKLKDKQRTFSNGNGNE |
| Ga0207906_100309011 | 3300025052 | Marine | NEVMIKFLEKAVNKLQNDVEKLKDKQRDFSNGTRTH |
| Ga0208011_10743991 | 3300025096 | Marine | NDVNIQALEKAVEKLQNDVEKLKDKQREFSNGDTH |
| Ga0208433_10715771 | 3300025114 | Marine | NEVNIKALDKAVEKLQADVEKLKDKQRTFSNGDTH |
| Ga0208433_10838573 | 3300025114 | Marine | NEVMIKFLDEQVKKLQEDVEKLKDKQRDFSNGNHQ |
| Ga0209644_10327435 | 3300025125 | Marine | NEVNIKALEKAVEKLQSDVEKLKDKQRSFSNGDTQ |
| Ga0209644_10453115 | 3300025125 | Marine | IHNEVMIKFLDEQVKKLQSDVEKLKDRQREFTNGKIQ |
| Ga0209644_10792611 | 3300025125 | Marine | NEVGIKALDKAVEKLQSDVEKLKDKQRSFSNGGQE |
| Ga0209644_10793061 | 3300025125 | Marine | VDSMLHNEVGIKALDKAVEKLQTDVEKLKDKQRSFSNGDTQ |
| Ga0209644_11068791 | 3300025125 | Marine | MLHNEIGIKALEKAVDKLQSDVEKLKDKQREFSNGDQ |
| Ga0209644_11123691 | 3300025125 | Marine | NEVMIKFLDEQVKKLQTDVEKLKDKQRDFTNGNSQ |
| Ga0208299_11044351 | 3300025133 | Marine | QAQQEAGIHNEVMIKFLEEQVKKLQEDVEKLKDKQRDFSNGSKE |
| Ga0207876_10438471 | 3300025259 | Deep Ocean | MLHNEVGIKALDKAVDKLQKDVEKLKDKQRDFANGDQ |
| Ga0208029_10460325 | 3300025264 | Deep Ocean | HNAVNIEALEKAVEKLQIDVEKLKDKQREFSNGSNH |
| Ga0208183_10611391 | 3300025274 | Deep Ocean | VDSMMHNEVNIEALTKAVNKLQSDVEKLKDRQRQFANGE |
| Ga0208030_11519023 | 3300025282 | Deep Ocean | NEVNISALTKAVDKLQSDVEKLKDKQREFGNGGNH |
| Ga0208030_11684172 | 3300025282 | Deep Ocean | HNEVNITALNKAVEKLQGDVEKLKDKQRSFANGNNH |
| Ga0208316_10670613 | 3300025296 | Deep Ocean | LHNEVNISALTKAVEKLQSDVEKLKDKQREFGNGGNH |
| Ga0208316_10992951 | 3300025296 | Deep Ocean | MLHNAVNIDALTKAVEKLQLDVEKLKDKQREFSNGGTH |
| Ga0208181_10698331 | 3300025300 | Deep Ocean | HNEVNIKALEKAVTKLQSDVEKLKDKQREFGNGNSH |
| Ga0209757_100154391 | 3300025873 | Marine | MLHNEVGIKALDKAVDKLQKDVEKLKDKQRQFANGNQ |
| Ga0209757_100319311 | 3300025873 | Marine | GIHNEVMIKFLDQQVKKLQDDVEKLKDRQRDFTNGTQ |
| Ga0209757_100361965 | 3300025873 | Marine | EAGIHNEVMIKFLDEQVKKLQSDVEKLKDRQREFTNGKIE |
| Ga0209757_100692621 | 3300025873 | Marine | LHNEVGIKALDKAVEKLQSDVEKLKDKQRSFSNGDIQ |
| Ga0209757_101630981 | 3300025873 | Marine | HNEVGIKALDKAVDKLQSDVEKLKDKQRTFSNGGQE |
| Ga0209757_101689723 | 3300025873 | Marine | HNEVMIKFLDEQVKKLQSDVEKLKDRQREFTNGKIQ |
| Ga0209757_102080241 | 3300025873 | Marine | NDVNIKALEKAVDKLQKDVEKLKDKQRTFSNGNGND |
| Ga0209757_102764001 | 3300025873 | Marine | LHNEVNITALNKAVEKLQSDVEKLKDKQRQFANGSR |
| Ga0208317_10156771 | 3300026117 | Marine Oceanic | MLHNEVGIKALDKAVDKLQKDVEKLKDKQRQFANGGQ |
| Ga0310122_103419463 | 3300031800 | Marine | SMLHNEVGIKALDKAVDKLQKDVEKLKDKQRDFANGEH |
| Ga0315318_1000138113 | 3300031886 | Seawater | SMTHNEVNINVLKDDVDDLKDDVERLKDKQREFSNGNK |
| Ga0326755_007591_876_992 | 3300034628 | Filtered Seawater | MLHNEIGIKALDKAVDKLQRDVEKLKDKQRTFSNGGQE |
| Ga0326755_028309_219_332 | 3300034628 | Filtered Seawater | MLHNEVGIKALDKAVDKLQKDVEKLKDKQRSFSNGGQ |
| Ga0326756_049745_412_519 | 3300034629 | Filtered Seawater | NEVGIKALDKATEKLQNDVEKLKDKQRDFANGDHQ |
| Ga0326741_015196_42_164 | 3300034654 | Filtered Seawater | MLHNEVGIKALEKAVEKLQSDVEKLKDKQRSFSNGEHNAQ |
| Ga0326748_019815_789_899 | 3300034656 | Filtered Seawater | LHNEVGIKALDKAVDKLQKDVEKLKDKQRQFANGGQ |
| Ga0326751_027336_434_547 | 3300034658 | Filtered Seawater | MLQNEVGIKALNKAVEKLQSDVEKLKDKQRDFANGNQ |
| ⦗Top⦘ |